KEGG   Ricinus communis (castor bean): RCOM_0665170Help
Entry
RCOM_0665170      CDS       T01087                                 

Definition
Regulatory-associated protein of mTOR, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
rcu  Ricinus communis (castor bean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1221 aa AA seqDB search
MAPQKALDTIGKTLSVQYERWQPKARYKVQLDPTVEEVKKLCNTCRKYAKSERVLFHYNG
HGVPKPTANGEIWLFNKSYTQYIPLPISDLDSWLKTPSIYVFDCSAAGMVVNAFLELHDW
NSSSSTGSVKDCILLAACEAHETLPQSAEFPADVFTSCLTTPIKMALRCESVLASFWGME
EHLIHKLAYYEERQLKVHLASLNPCFLLTHEYVQTNMWQNKVFHLFQRLFRQDLLVASLF
RNFLLAERIMRSANCSPISHPMLPPTHQHHMWDAWDMAAEICLSQLPSLVEDPNAEFQPS
PFFTEQLMAFEVWLDHGSEDKKPPEQLPIVLQVLLSQCHRFKALVLLGRFLDMGSWAVDL
ALSVGIFPYVLKLLQTTTPELRQILVFIWTKFWHLISSILWSQSCQVDLVKDGGHTYFIR
FLDSMEAYPEQRAMAAFVLAVIVDGHRRGQEACIEAGLIHVCLKHLRGSMPNEGQTEPLF
LQWLCLCLGKLWEDFTEAQIIGLQADAPSIYAPLLSEPQPEVRASAVFALGTLLDIGGDA
CRDSVAGDEEYDDDEKVRAEISIVKSLLNVVSDGSPLVRAEVAVALARFAFGHKQHLKSI
AAAYWKPQSNTLLNSLPSLAHIKGTGILSSQIGPLTRVGNDNPSVVRDGRVSTSSPLATS
GIMHGSPLSDDSSQHSDSGMLNDVVSNGVAHHSRPKPLDNAMYSQCVLAMCTLAKDPSPR
IANLGRRVLSIIGIEQVVTNPVASAGGSGRPGEPTTSSPSPSLAGLARSSSWFDMNAGHL
PLTFRTPPVSPPRPSYLTGMRRVCSLEFRPHLMSSPDSGLADPLLGSVGPSGGSERSLLP
QSTIYNWSCGHFSKPLLNTADDTEVMLVKREEREKFAMDHISKCQHSSVSKLNNQIAGWD
TKFETGTKAALLHPFSPIVIAADENERIRVWNYEDAVPLNGFDNHAFPDKGISKLCLVNE
LDDSLLLVASCDGNIRIWKDYTIKGKQKLVTAFSSIQGHKPGVRSLNAVVDWQQQSGYLY
ASGELSSVMLWDLDKEQLVNSIPSSSDCSISALSASQVHGGQFAAGFVDGSVRLYDVRTP
ERLVCAKRPHTRAERVVGIGFQPGLDPGKFVSASLAGDIEFLDIRNPRDTYLTINAHRGS
LTSLAVHRHAPTIASGSAKQIIKVFSLEGEVLGTIRYYSTFMAQKIGPVSCLTFHPYQVL
LAAGAADAWVSIYTDENSQAR
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcaaaaagctcttgacacaattgggaaaaccttgagtgtgcagtatgaaaga
tggcaacctaaggctcgttataaagtgcaacttgatcctactgtggaagaggttaagaaa
ctttgtaatacatgtcgaaaatatgcaaagtcagagagagttcttttccattataatggt
catggtgttccaaagcctactgccaatggtgaaatctggctattcaacaagagctataca
cagtatatccccttgccaatcagtgatcttgattcctggttgaagactccatcgatatat
gtttttgattgctctgctgctgggatggttgtcaatgcctttttagagcttcatgactgg
aattcttccagctctactggatctgtgaaggactgtattttgcttgctgcctgtgaagca
catgagactcttcctcagagtgcagaatttcctgctgacgtgtttacttcttgcctcacc
acaccaatcaagatggcattgagatgcgagtcagtcttggcttcattctggggaatggaa
gaacatctgattcacaaattggcatattacgaagaaaggcaacttaaagttcacctggct
tctttaaacccctgtttcttgctaactcatgaatatgtacagacaaatatgtggcagaac
aaggtttttcatctttttcaaagactgttcagacaagatttattagttgccagtctgttc
agaaattttctactggctgagcgaattatgcgttctgctaattgttctccaatttctcat
ccaatgttaccgccaactcatcagcatcatatgtgggatgcatgggatatggctgctgaa
atttgcctctctcagcttccgtctctggttgaggatcctaatgcagagttccagccaagt
cctttcttcactgaacagctgatggcttttgaggtttggttggatcatggatctgaagat
aagaagccgccggagcagttgccaattgttcttcaggttctacttagccaatgccatcgg
tttaaagcgctggtgcttcttgggagattcctggatatggggtcctgggcagtggatctg
gcgttatctgttggaatatttccatatgttctgaagctgttgcaaacaacaacaccagaa
ctaaggcaaattcttgtattcatatggacaaaattctggcacttgataagctctatcctg
tggtcacagtcatgccaagttgatcttgttaaggacggggggcatacatattttatcagg
tttcttgatagcatggaagcatatccggaacagcgagcaatggctgcatttgttttggct
gttattgttgatggacaccgaaggggtcaggaagcttgtattgaagctggtttaattcac
gtgtgcttgaagcatcttaggggttcaatgccgaatgaaggtcaaactgaaccgctattt
cttcaatggctctgcctatgcctggggaagttgtgggaggatttcacagaggcacaaata
ataggtttgcaggcagatgcacctagtatatatgctcctctactctccgagccccaacct
gaggttagggcttctgctgtgtttgcactgggtaccctgcttgatattgggggtgatgca
tgtcgagatagtgttgcaggcgatgaggaatatgatgatgatgaaaaagttagagctgaa
attagcattgttaaaagtcttctgaatgttgtttcagatggcagcccactggtcagggca
gaggttgctgtagctctagcccgctttgcatttggccacaagcagcacctcaagtcaatt
gctgcagcatattggaaacctcagtcaaatactcttctgaactccttaccttctttggcc
catatcaaaggtacaggtattctttcatctcaaattggtcctttaacgagagttggcaat
gacaacccatcagtggttcgggatggaagagtctccactagcagtccacttgctacatct
ggaataatgcatggttcgcccttatctgatgattcatctcaacattctgattctggtatg
ttgaatgatgtggtcagcaacggggtcgctcaccattcgaggcccaaaccgttggataat
gcaatgtattcacagtgtgtactggctatgtgtactttggctaaggatccttctccacgc
attgccaaccttggccggagagtgctatccattattgggattgagcaagtagtgacaaat
cctgttgcctccgctggtggtagcggtcggcctggtgaacctacaacttcatctccatct
ccaagtcttgcaggactagctcgttcatcatcatggtttgacatgaatgcaggtcatttg
cctttaacattcagaactcctcctgtcagtcctcctcgaccaagttatctaacagggatg
cgcagagtttgttctttagagttcaggccacacctaatgagttctccagattcaggatta
gctgatcctcttttaggttctgttggaccttctgggggctcagaacggagtttacttcct
caatcaactatttataactggagttgtggtcacttttcaaagccacttcttaatacagca
gatgacactgaagtaatgttggttaaaagagaagagagggagaaatttgcaatggatcat
atttcgaaatgtcagcactcatctgttagcaagttaaataatcaaattgcaggctgggac
acaaagtttgaaactggcacaaaggcagcattgttgcatcctttctctcctattgtcatt
gctgctgatgagaatgaaaggatcagggtatggaattatgaggatgcagtgcccctcaat
ggatttgataatcatgcttttcctgacaaaggaatttctaagctctgccttgtaaatgag
cttgatgacagtttgcttcttgttgcttcatgtgatggaaatattcggatttggaaagat
tatactatcaagggtaaacaaaagcttgtcactgctttttcttcaatccagggtcacaaa
cctggtgtgcggagtttgaatgctgttgtggattggcaacagcaatctggatatctgtat
gcctctggtgagttatcttccgtcatgctttgggacctcgataaagagcaacttgttaat
tctattccatcatcatctgattgcagtatctcagcattgtctgcttctcaagttcatggg
ggtcaatttgctgctggtttcgtggatggttctgtcagattatatgatgtccggacacct
gaaaggcttgtttgtgctaagcggccccatacgagagcagaaagagttgtagggattggc
tttcaacctggtcttgatcctgggaagtttgtcagtgcatctctggctggtgacattgaa
ttcctggatatcagaaatcctagagatacctacttaacgattaatgctcacaggggctca
cttacgtctttagctgttcatcggcatgctcctaccatcgccagtggctcagcaaaacaa
attattaaagtattcagcttggagggtgaagtactgggcactattcggtattactcaact
ttcatggcccagaagattggacctgttagctgtctcaccttccatccgtaccaagtactg
cttgcggctggtgctgcagatgcttgggtttcgatatatactgacgaaaactctcaagca
agataa

DBGET integrated database retrieval system