KEGG   Ricinus communis (castor bean): RCOM_0666560Help
Entry
RCOM_0666560      CDS       T01087                                 

Definition
4-alpha-glucanotransferase, chloroplast precursor, putative (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RCOM_0666560
Enzymes [BR:rcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RCOM_0666560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MAVLSSVTLLPSPSHFNTNLYRSSSSSSIPFSLFNIQSRRPLSTLISKANAVSSPSTISR
LSSTSVGEDLPSDYEDWLPKRQGKRRAGILLHPTSFRGPHGIGDLGDEAFRFIDWLHHSG
CSVWQVLPLVPPDEGGSPYSGQDANCGNTLLISLEELVKDGLLTKDELPERVCSDRVNFS
AVTELKNPLIAKAAERLILSDGELKIQFEDFRKDPNISSWLEDAAYFAAIDDTLNTLNWY
DWPESLKNRHLAALEGIYQSKKDFIEIFIAQQFLFQRQWQKVRSYAQEKGISIMGDMPIY
VGYHSADVWANKRHFLLNRKGFPLLVSGVPPDAFSNTGQLWGSPLYDWEAMERDNYSWWV
CRIQRAQHLYNEFRIDHFRGFAGYWAVPSDAKVAMVGNWKAGPGKSLFDAITRAVGKISI
IAEDLGVITEDVVQLRKSIGAPGMAVLQFGFGSDADNPHLPHNHDANQVVYTGTHDNDTI
RGWWDVIKQEEKSNVLKYLSIAEEDEIPWALIKAALSSVAETAVIPLQDILGLGNSARMN
IPATQLEQGHIWIGSARLVLVLLLVPNQSTSRSTKQVKLGVEQS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccttagctctgtcacactccttccttctccatctcattttaacaccaacctc
tatcgctcttcttcttcttcttccattcctttctctctcttcaacattcaatccagacgt
ccactctccactctcatttccaaagctaacgccgtctcttcaccatccactatttctcgc
ttatcttccacttccgtcggcgaggacttgccgtcagattatgaagattggttacctaaa
cgtcaagggaagaggagagctggcattttgctccatccgacgtcgttcagagggccccac
ggtattggagatctcggggatgaggcttttcgcttcattgattggcttcatcactctggt
tgctctgtttggcaggtgcttcctcttgtacctccagatgaaggaggatcaccatactca
ggccaggatgctaattgtggtaatactctcttaatttctcttgaagagcttgtcaaggat
ggtttgctgacaaaggatgagctgccagagcgagtatgctctgatcgtgtgaacttttct
gctgttactgagctaaagaatcccttgatagctaaggctgcagagaggcttattctgagt
gatggtgaacttaaaattcagtttgaagattttcgcaaggaccccaatatatcaagttgg
ctggaggatgcagcttattttgctgctattgatgatactttaaataccttaaattggtac
gattggcctgaatctctgaaaaaccgccatcttgcagctctggagggcatttaccaaagc
aaaaaggattttatagagattttcattgcccagcagtttttgttccagagacaatggcag
aaagttcgcagctatgcacaggaaaagggtattagtataatgggtgacatgcccatttat
gtaggctatcatagtgctgatgtttgggcaaataagaggcattttttgctgaacaggaaa
ggctttcctcttctagttagtggtgttccccctgatgccttcagcaatactggtcaattg
tggggcagccctctctatgattgggaagccatggagagagataattattcatggtgggta
tgccgtatacaacgagctcaacatctgtacaatgaatttaggattgaccactttagaggt
tttgctggctattgggctgttccttctgatgcaaaagttgcaatggtcggaaattggaag
gctgggcctgggaaatccctatttgatgccatcaccagagctgttggaaagatcagcata
atagcagaggatttgggagttatcactgaggatgtagtacagcttagaaaatctattggt
gctcctggaatggctgttcttcagtttggttttggaagtgatgcagataaccctcattta
cctcataatcatgacgcaaatcaagttgtatacactggaactcatgataatgacacgatt
cgaggttggtgggacgtgataaagcaagaggagaagtcaaatgtattgaagtatctttca
attgctgaagaagatgagatcccatgggcactcatcaaagccgcgctttcatcagtagcc
gaaactgcagtaatacccctgcaagatattcttggattggggaattctgccagaatgaat
attcctgctactcagcttgaacaaggacatatttggattggctccgctcgtctcgttctt
gtcctactactagtccctaatcagtccacctccagatctaccaagcaagtgaagttggga
gttgaacagagctga

DBGET integrated database retrieval system