KEGG   Ricinus communis (castor bean): RCOM_0689730Help
Entry
RCOM_0689730      CDS       T01087                                 

Definition
dihydropteroate synthase, putative (EC:2.7.6.3 2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCOM_0689730
Enzymes [BR:rcu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RCOM_0689730
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RCOM_0689730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MILFKRLMPTKQGLGNAIRHLRGSSFCFLHSAPDGYVELHSEEQEVVIALGSNVGNRLHN
FNQALQLMKKSGININRHGCLYETAPAYVTDQPHFLNSAVRAVTKLGPHELLRVLKTIEK
DMGRTDGIRYGPRPIDLDILFYGKFRIHSDTLAVPHERIWERPFVMAPLMDLLGSDIEND
TVACWHSLSIHSGGLFESWENLGGENLIGKDGMKRVIPAGNQLLDWSQRTSVMGIINLTP
DSFSDGGKFQSINSVVSQVHLMISEGADILDFGAQSTRPMASRISPQEELDRLMPILEAV
VKIPEMNGKLISVDTFYSEVALEAVKKGAQLVNDVSGGQLDPNMTKVVAGLEVPYVAMHM
RGDPTTMQNSENLQYHDVCKQVASELYSQIKEAELSGIPAWRIIVDPGLGFSKNKEHNVE
ILTGLPAIRAEIAKKSLAISHAPILIGPSRKRFLGDICNRPAAMERDPATLLQSLLGFLE
VQICEST
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcttcaagcggctgatgcccaccaaacaagggcttggcaatgccatcaggcac
cttagaggatcttccttctgctttctccattcagccccagatggatatgtggaacttcat
tctgaagagcaggaagtagtaattgctctgggaagcaatgtgggtaatagactccataat
tttaatcaagccttgcagttgatgaagaaatctggcattaacattaatagacatggttgc
ttgtatgagacagcacctgcctatgttactgatcagcctcattttcttaactctgctgtt
agagctgttacaaaacttgggccacatgagttgttgcgagtgcttaagacgattgagaag
gacatgggtcgtactgatgggataaggtatgggccaaggcccattgatttggatatattg
ttctatgggaagttcaggattcattctgacacacttgcagtccctcatgagagaatatgg
gaaagaccatttgtaatggccccattaatggatttgctgggatcagatattgagaatgat
acagtagcttgctggcattctttgtcaatacattctggtggactttttgaatcatgggag
aacttgggtggtgaaaacctcattgggaaggatggcatgaaaagagtgataccagctgga
aatcaactgttggattggtcgcagagaacttctgtgatgggcattattaatttgacacca
gatagttttagtgatggaggaaagttccagtctatcaattctgttgtttcccaggtccac
ttgatgatttcagaaggggcagatattcttgattttggtgctcaatcaacaaggccgatg
gcctctaggatttcccctcaggaggaattagatagactaatgcccatcttggaagctgtt
gtaaagatacctgagatgaatggaaagctcatatctgtggacaccttttactcagaagtt
gctttagaagcagtcaaaaagggagctcaacttgtgaatgatgtatctggtgggcagttg
gatcctaacatgactaaggttgttgctggtcttgaggttccttatgttgcaatgcatatg
agaggagacccaactacaatgcagaatagtgagaacctgcagtatcacgatgtttgcaag
caagttgcctctgagttgtactcgcagattaaagaagcagaattatcaggaatcccagct
tggaggattattgttgaccctggacttggcttttcgaagaacaaagagcataatgtggaa
atcctcacgggattaccagctattcgagcagagattgcaaagaaaagcttggccatttct
catgctcctatacttataggaccttccagaaagagattcttgggtgatatttgcaatcgc
ccagcagcaatggaaagagatcctgcaacattgcttcaatcactgctgggattcttggag
gtgcaaatatgtgagagtacataa

DBGET integrated database retrieval system