KEGG   Ricinus communis (castor bean): RCOM_0691140Help
Entry
RCOM_0691140      CDS       T01087                                 

Definition
tryptophan biosynthesis protein, trpc, putative (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCOM_0691140
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCOM_0691140
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RCOM_0691140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 389 aa AA seqDB search
MEGLVSARVSLRTAPSLYLNPNFSIKPSTNLLTLNTRFSVPSIRAQQPDTKEGLAMVEEE
SNVLKVKEWEVGMLQNEVAASQGIRIRRRPPTGPPLHYVGPFEFRIQNEGNTPRNILEEI
IWHKHTEVSQLKERRPLSVLKNSLDNAPPTRDFIGALKAANLRIGFPGLIAEVKKASPSR
GILREDFDPVEIAQAYEKGGAACLSVLTDEKFFKGSFENLEAIRNSGVKCPLLCKEFVID
AWQIYYARTKGADAILLIAAVLPDLDIKYMTKICKVLGLTALIEVHDEREMDRVLAIEGV
ELIGINNRNLETFEVDISNTRKLLEGERGQLIQQKGIIVVGESGLFTPEDIAYVHEAGVK
AVLVGESIVKQSDPGKGITGLFGKDISLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaggattggtttcagctagggtttctctaaggactgctccttccctctaccttaac
cccaacttctcaatcaaaccttcaaccaacctccttacactcaatactcgtttctctgtt
ccctcaattagagctcaacagcccgatacgaaggagggattggctatggtggaggaggag
tcgaatgtgcttaaagtgaaggaatgggaagtgggtatgcttcaaaatgaagtggctgct
agtcaagggattagaattaggagaaggccgccaactggtccgcctttgcattatgttgga
ccgtttgaatttcgtatacagaatgagggcaatacacctaggaatattcttgaggaaatt
atttggcataagcatactgaagtttctcaattgaaagagagaaggcctctttcagtgctg
aagaattcattagacaatgctcctcctactagagattttatcggagctcttaaggctgct
aatcttcgaattggatttcctggtttgattgctgaagttaagaaagcttctccgagtaga
ggaattttaagagaggactttgatcctgttgaaattgcccaagcttatgagaaaggtggc
gctgcatgtctcagtgttttgactgatgaaaagttttttaaggggagctttgaaaacctg
gaggctataaggaattcaggagtaaagtgcccactattgtgcaaagagtttgtcatagat
gcatggcaaatctactatgcccgaactaaaggcgcagatgccattcttttaattgctgct
gttttgcctgatcttgacatcaaatacatgacaaagatatgcaaagtgcttggtttgaca
gcactaatcgaggtgcacgatgaaagggaaatggatcgtgttcttgcaatagagggagtt
gaacttattggtatcaacaaccgtaatcttgaaacattcgaggttgatattagtaacacg
aggaagcttcttgaaggagagcgtggtcaacttatacaacaaaaaggcataattgttgtt
ggggaatctggtctatttactcctgaagacattgcttatgtgcatgaagctggagtgaaa
gctgttttggttggagaatcaattgtgaagcaaagtgaccctgggaagggaataacggga
ctttttggtaaagatatttcattgagttaa

DBGET integrated database retrieval system