KEGG   Ricinus communis (castor bean): RCOM_0707630Help
Entry
RCOM_0707630      CDS       T01087                                 

Definition
endo-1,4-beta-glucanase, putative (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RCOM_0707630
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RCOM_0707630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MGTSKRPSLAIIMAWLTLMQGLLVAVNGHFNYKDALAKSIIFLEAQRSGKLPPNNRLPWR
GDSALEDGKLVNVDLVGGYYDAGDNVKYGLPMAFTVTTLAWSTLAYKKELQAVGEFENAV
AGIKWGTDYFLKASSRRNRLYVQVGDPELDHQCWVRPEVMQTPRTVLQIDEKDPGTEIAA
ETSAAMAAASMVFRSLNHTYARRLLNKAKLLFTLAKAHKATYDGECPFYCSYSGYNDELM
WAATWLYMASKKSMYLKYVMNEAINANVAEFSWDLKYAGAQILLSQFFFQGEQGLASHKN
GADSFICSNHPESPYHQVYISPGGVLHLRDGANSQYVTGAALLFSVYSDILRQYNQKVNC
GDKQLDADSLMSFAHQQMDYLLGNNPQKRSYMVGFGNNPPKEPHHRGASVPRTQANQVVS
CPMSFVYWFNQNGPNPNELTGAFVGGPDKLDNFVDKRSASSFTEPCTYVNSLAVGVLAKL
AAHA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgggtacctcaaaaagaccttctttggccattataatggcatggttaactctaatgcaa
ggacttttggttgctgttaatggtcattttaattataaggatgcacttgctaagtcaatt
attttcctagaagcacaaagatcaggaaaactccccccaaataacaggctaccttggaga
ggagattctgccctagaggatggtaaacttgtaaacgtggaccttgtgggaggatattat
gatgcaggagacaatgtgaaatatggacttcctatggcttttacagtaacaactctagca
tggagtactctcgcttataaaaaagagttacaagctgtaggcgagtttgaaaatgcggtt
gctggcatcaaatggggcacagattattttctaaaagctagtagtagacgcaaccgtttg
tatgtgcaggtgggagatccagaacttgatcatcaatgttgggttagaccagaagttatg
caaacaccaagaactgtgttacaaattgatgagaaggatcctggaacagagattgcagca
gaaacttcagctgcaatggctgctgcttccatggtatttagatccttaaatcacacatat
gctcgtcgtctcctcaacaaggccaaactgctttttacattggctaaggcacacaaagca
acatacgatggagaatgccccttctactgctcttactctggctacaatgatgagctaatg
tgggcagcaacatggctatacatggcaagcaagaagtctatgtacttgaaatatgttatg
aacgaagccattaatgctaatgttgctgagtttagctgggatctcaaatacgctggagca
caaatcctactctctcagtttttcttccaaggagagcaaggtttagcctctcataaaaat
ggagctgacagtttcatatgctcaaaccatcctgaaagcccctaccatcaagtttatatc
tctccaggtggtgtccttcacttgagagatggagccaacagtcaatacgttactggagct
gctttattatttagtgtctacagtgacatcctcagacaatacaaccagaaagtaaattgt
ggagacaagcaacttgacgcagacagcctcatgagctttgcccatcagcagatggactac
ctgctaggaaacaacccacagaaaagatcatacatggtaggtttcggaaacaacccacca
aaggaaccacatcatagaggagcatcagtaccaagaacacaagcaaatcaagtagtgagc
tgtccgatgagcttcgtgtactggttcaaccaaaatggcccaaatccaaatgagctgaca
ggtgcatttgtgggtggacctgacaaacttgataactttgtggacaaacgatcagcttct
tcatttacagagccatgcacttatgttaactctcttgcagttggcgttctggcaaagcta
gcagcccacgcatag

DBGET integrated database retrieval system