KEGG   Ricinus communis (castor bean): RCOM_0714220Help
Entry
RCOM_0714220      CDS       T01087                                 

Definition
Chalcone--flavonone isomerase, putative (EC:5.5.1.6)
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    RCOM_0714220
Enzymes [BR:rcu01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     RCOM_0714220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 176 aa AA seqDB search
MSPLSATHIVIEAVSFPPAVKPPASDKTLFLAGAGVRGLEIEGKFVKFTAIGVYLEDDAV
PLLAVKWKGKTAQELTDSVEFFREIVTGPYEKFIRVTMILPLSGQQYSEKVAENCVAIWK
SFGIYTDAEAKAIDKFLEIFKEENFPPGSSILFTQLPHGSVAVSNLGTAPSEHCIQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctttcagctactcacattgtcatcgaagccgtctctttcccgccggcggtc
aagcctcctgcctctgataaaaccctcttccttgctggcgcaggggttagaggattggag
atcgaagggaagttcgttaagtttactgcgattggggtgtatttagaggatgacgctgtg
cctttgttggctgtgaagtggaagggcaagactgctcaggagctcacggattctgttgag
ttcttcagagaaattgtcacaggtccatatgagaagttcatccgagtaacaatgatcttg
cctttaagtggtcaacagtactcggagaaagttgcagaaaattgtgttgcaatttggaaa
tctttcggaatttacactgatgcagaagctaaagctattgataaattcttagaaatcttc
aaagaagaaaattttcctcctggttcctctattcttttcacacaattgcctcatggatcg
gttgcggtaagtaatttaggaactgcaccatctgaacattgcatacagtaa

DBGET integrated database retrieval system