KEGG   Ricinus communis (castor bean): RCOM_0723010Help
Entry
RCOM_0723010      CDS       T01087                                 

Definition
big map kinase/bmk, putative (EC:2.7.11.24)
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Plant hormone signal transduction
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    RCOM_0723010
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    RCOM_0723010
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     RCOM_0723010
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   RCOM_0723010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MNAAGPDTEMEDASTAAASAAPPPPSSDPHQPPPPAGGMENIPATLSHGGRFIQYNIFGN
IFEVTAKYKPPIMPIGKGAYGIVCSALNSETAEHVAIKKIANAFDNKIDAKRTLREIKLL
RHMDHENVVAIRDIIPPPKRELFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQIL
RGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRAPEL
LLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEAELGFLNEN
AKRYIRQLPLYRRQSFTDKFPNVHPAAIDLVEKMLTFDPRLRITVEDALAHPYLTSLHDI
SDEPVCTTPFSFDFEQHALTEDQMKELIYREALAFNPEYQQQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgctggacctgacaccgagatggaggatgcctccaccgccgccgcttcagca
gcgcctccaccgccttcttctgaccctcaccaacctcctcctccggccggaggcatggag
aatattccggcaacgctaagtcacggcggacggttcatacaatacaatatctttggcaac
atattcgaagtcaccgctaaatataagcctcctattatgcctatcggtaaaggcgcatac
ggcatcgtttgctctgcgttgaattcggagacggcagagcatgtagcaataaagaagata
gcgaatgcatttgataataaaatcgatgctaaaaggactcttcgtgagatcaaattgctc
cgtcatatggatcatgaaaacgttgttgcaatcagggatataatccccccacccaagaga
gaattgttcaatgacgtttatatcgcttatgagctaatggacactgatctccatcagatc
attcgttcgaatcaagcattatcagaggagcactgccagtattttctgtatcaaattctc
cgaggattgaaatatatacattccgcaaatgttctgcatagagatttaaaaccaagcaat
cttctcctaaatgcaaattgtgacctgaagatatgtgactttggtctagctcgtgttacc
tcagaaactgatttcatgacagaatatgttgttacaagatggtatcgtgcaccagagctg
ctgttaaactcttcagattacactgcagctattgatgtatggtcagtaggttgcattttc
atggagttgatggatcggaagcccctatttccaggcagagatcatgtgcatcagcttcgt
ttacttatggagctaattggcactccatcagaggcagagttgggatttttgaatgaaaat
gccaagagatacattagacaacttcctctttatcgccgacaatctttcactgataagttt
ccaaatgtccacccagcagctattgatcttgtcgaaaagatgttaacatttgatcccaga
ttaaggattacagttgaggatgcgctcgctcatccgtatctaacttcacttcacgacata
agtgatgagccagtctgcacgaccccattcagctttgactttgagcagcatgctttgact
gaagatcagatgaaggagctgatttaccgggaggctcttgcttttaacccagagtatcag
cagcaatag

DBGET integrated database retrieval system