KEGG   Ricinus communis (castor bean): RCOM_0727440Help
Entry
RCOM_0727440      CDS       T01087                                 

Definition
mitogen activated protein kinase kinase, putative (EC:2.7.12.2)
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:rcu04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MRPIQPPPPSPGTATATATATATATATATATATGNRNRSRRRPDLTLPLPQRDPKLAVPL
PLPPSSAPSTSDYNNNNSNNHNHNHNHNNGSNQQQHQRQLFSELERIRIIGRGSGGTVFK
AIHHSSGKLFALKVIYGYHEDSVRIQICREIEILRGVNHPNVVKCHDFHEHGGEIQLLLE
FMDGGSLEGTHIGHEPQLADVARQILNGIAYLHRRKIVHRDIKPSNFLIDSRKNVKIADF
GVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGKYDGCAGDIWSLGVSMLEFYLGRFP
FAVGRQGDWASLMCAISMSQPPEAPPTASREFRNFIACCLQREPARRLSAVQLLDHPFIA
RNTAAQREGNQNLHQLLPPPRPLSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgattcaaccaccgccaccgtcaccaggcacagcaacggcaacggccacagca
acggcaacagcaacagcaacagcaacagcaacggcgacaggcaatcggaaccggtcacga
aggcgaccagacctaaccctacctctcccgcaacgagacccgaaactagcagttcctctt
cctttaccaccatcgtcagcgccatcaacgagtgattataacaacaacaacagcaataat
cataatcataatcataatcataataacggcagtaatcaacagcaacatcaaaggcaattg
ttctcagagctcgagcgcatcaggataataggaaggggaagcggtggtactgtcttcaaa
gcaatccatcattcttctggtaaactctttgctctcaaagttatttacggttatcacgag
gactctgttaggattcagatctgccgcgagatcgagatccttcgcggagttaatcatcct
aatgttgtcaaatgtcatgattttcatgaacatggtggtgagatccaactcttgcttgaa
tttatggatggtggctctttggaaggcacccatattggccatgaacctcagttggctgat
gttgctaggcaaatcttgaatggtattgcttacttacatcgcagaaagattgtccacagg
gatatcaaaccctccaattttttaatcgattctagaaagaatgtcaagattgctgatttt
ggtgtcagtagggttcttgcccagacaatggatccatgtaactcatcagttgggacaatt
gcttatatgagtccagaaaggattaatactgatttgaatcatggaaagtatgatggctgt
gcaggtgatatttggagtttaggggttagtatgttggaattttatttgggtaggttccca
tttgctgttggaagacaaggtgattgggctagtttgatgtgtgctatttctatgtcacaa
ccacctgaggcaccacctactgcttcgagggagtttcggaattttatagcttgttgtctg
cagagagaaccggctcggaggttgtcagctgttcaattgctagaccatccttttatagca
aggaatactgctgctcaaagagagggtaatcagaatcttcatcaactattgcctccccct
cgccctctttcttcttag

DBGET integrated database retrieval system