KEGG   Ricinus communis (castor bean): RCOM_0746930Help
Entry
RCOM_0746930      CDS       T01087                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 870 aa AA seqDB search
MLEPREADMPVLFMVLVVLPLVVYILLGKWSEATRKRERISLLAELAAEEALRAQAIKPI
PISFPFVSTTKNGIHVCARCLSPATTRCSRCKSVRYCSGNCQIIHWRQVHKQECQQLETT
SSCSSPKATSIQDSFPERGTVDDSLDKFYSRYSNKQVFVDNITSDKTVHPSISNGVSAAS
SSAVETSQDAMLRKISTNKYAYRKSRGNLEETSGCGNLMSSNIASDVHINGHCNACTKNV
LHDLQPGKMFESRNKSSCANAGKNGRKIHETETDFTWNGGNMPNVENNLNDQTVELNCSY
EAPVMKENERAKFASQPTGTKISKSSKSTMKVFAEPSYTGVEEKGLSGDDSKDVRMRHAI
PAPGSNGVASTGIMKMVGLRKSAKLTRQDAAELSGRQRKLMMLFPYEEFVKIFNCEVANL
SPRGLLNCGNSCYANAVLQCLACTKPLIIFLLHRSHSRACCGGDWCLMCELEKHVIMLRQ
CGGPLSPSRILLHIQNVNCQIGDGSQEDAHEFLRLLVACMQSTCLKELGGEDKVSPVLQE
TTFIQHTFGGSLRCATYVRARKQLSIHEAPNILTIVLKRFQEGKHGKINKYITFPDMLDM
IPYMTGTIDIPPLYMLYAVVVHLDTLNASFSGHYVAYVKDLQGNWFRVDDTEVRPVPMSQ
VMSEGVYILFYIRSCPRPQKEYFEAIQQQVPASAEHGIKSLKTQKPSRKGYCKSSSRLSG
PEPLLDLKPQNITGNINRNVMQVMEFSDSTSSDWSLFTSSDEASFTTESTRDSFSTVDYA
DACNEDTFSSIFDNLYAPQSSRNPLCCRKFINSRSHTRFISEERGYVLDSYLSMQQLPRG
LHGEDSLEKVSDSSTECPTDSCCSMLGDPD
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaccaagggaagctgatatgcctgtgttgtttatggttttggttgtgcttcct
cttgttgtttacattttacttgggaaatggagtgaggctacaaggaagagagagaggata
agtttacttgctgaattggctgctgaagaagcacttagggcacaagcaataaagcctatt
cctatttcttttccctttgtgtccactacaaagaatggaattcatgtctgtgctagatgc
ttaagtcctgctactacccgctgctccagatgcaagtctgtcagatactgctctggaaat
tgtcaaataattcattggaggcaagttcataagcaagagtgtcagcaattagaaactacc
agttcatgctcatctcctaaggctacctcaatccaggactcctttcctgaaagaggaacg
gtcgatgacagcttggacaaattttactctcggtatagcaataagcaggtttttgtggat
aatataacttcagataagacagttcatccctcaataagtaatggggtctctgccgcctcc
agttctgcagttgaaacctctcaagacgccatgctacggaaaataagcacaaataagtat
gcttatcgtaaatccagaggaaatttggaagaaacatctggatgtggcaatttaatgtct
tctaatattgcctctgatgtgcatataaatgggcactgtaatgcctgtactaaaaatgtc
cttcatgatttgcaaccgggaaagatgtttgaatcaagaaacaaatcatcatgtgcaaat
gctggaaaaaacggaagaaagattcacgaaacagaaacagactttacatggaatggagga
aatatgcccaatgtagaaaataatttaaatgatcaaacagtagaattgaattgttcttat
gaagcacctgttatgaaggaaaatgaaagggctaaatttgcatcacagcctactgggact
aaaatttctaaatcatcaaaatcaacaatgaaagtctttgcagaaccatcatacacagga
gtagaggagaagggactaagtggagatgattcaaaggatgtcagaatgagacatgccatt
cctgcaccaggaagcaatggggttgcaagcactggtattatgaagatggtgggcttaagg
aaatcagcaaaacttactagacaggatgctgcagaacttagtggtagacaaagaaaattg
atgatgctgttcccttatgaagaatttgtcaagatcttcaattgtgaggttgctaactta
tcacctaggggacttctaaattgtggtaatagttgctatgctaatgctgtccttcaatgt
ttggcctgcacaaagccgttgataatcttcttgcttcatagatcacattcaagagcttgt
tgtgggggagattggtgtcttatgtgtgaacttgagaaacatgtaataatgttaagacaa
tgtggaggccctttatctcctagtagaatccttctgcatattcagaatgttaattgtcag
attggtgatggaagtcaagaagatgcacatgagttcttaaggcttctggttgcatgtatg
cagtctacttgtttgaaagaactcggtggtgaggacaaggtcagtcctgttttacaagaa
acgactttcatacagcatacctttggtgggagtcttaggtgtgctacatatgttcgagct
aggaagcaattaagcatacatgaagcaccaaacattcttacaattgttttgaagagattc
caggaaggaaaacatggtaaaataaataaatacattacttttcctgacatgctcgatatg
atcccatatatgactggaacaatcgatattccacctctttacatgctctatgctgttgtg
gtgcatttggatacattaaatgcatccttttctgggcattatgtggcatatgtaaaagat
ttgcaaggcaactggttcagggtggatgacactgaggttcgtccagtgccaatgagccaa
gtgatgtcagagggggtatacattttattttacatcaggtcttgtcctcgccctcagaaa
gaatattttgaagctatccagcaacaggttccagcatctgcagaacacggcatcaaatca
ctgaaaactcagaaaccttcgcgaaaaggatattgcaaatcaagcagccgtctttctggt
ccggagcctttacttgatctcaaaccacaaaatattacaggcaacataaacagaaatgtt
atgcaagtgatggaattctctgattctacatcaagtgattggtctctttttactagctca
gacgaggcttctttcactactgagagcaccagagactctttcagtactgtggattacgct
gatgcatgcaatgaagatacgttctcctcgatctttgataacctgtatgcaccacagtcc
tcaaggaaccctctttgctgtagaaagtttataaatagtaggtcacacactaggttcatc
tcagaggaaagaggctatgttttggactcgtacttgtcaatgcagcagctgccaagaggg
ttacatggagaagatagtttagaaaaggtcagtgattcttctactgaatgccctactgat
agttgttgtagcatgcttggggatcctgactga

DBGET integrated database retrieval system