KEGG   Ricinus communis (castor bean): RCOM_0751830Help
Entry
RCOM_0751830      CDS       T01087                                 

Definition
guanylate kinase, putative (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RCOM_0751830
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RCOM_0751830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MGEAPAFVFDDLQDANQNGFGLKSKDSGTAFTIRDKTYVIGCDDDESTLSIGVLIIDNAT
GNSIIPTVLGSKPKPCKGYSAVPLNDDRILIIKKGSAPDDCIWFLEVDTKYVKQQKNNLG
KEVVAWSKGVSGNAEKPVVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRAPRAMEKD
GVHYHFTERSVMEKEIREGKFLEFASVHGNLYGTSIEAVEVVADAGKRCILDIDVQGARS
VSASSLEAIFIFICPPSMEELEKRLRARGTEAEEQILKRLRNAKAEIEQGQSSGIFEHIL
YNDNLDECYENLKKLLGLDGTTVAMQKSTSQGINLPEDHSISKVDNKIIINCGTPELEKA
SKSFIILDASSLKGGAPGRTRGLDVHAIDSFSDGLNGINELS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggctccagcttttgtttttgatgatctgcaggacgcaaatcagaatggattt
ggtttaaaatctaaagactctggaactgcatttactattcgagataaaacttatgtgatt
ggttgtgatgacgatgaatccacattatctattggagttctcattatcgataatgctact
gggaattcgataattccaactgtactgggatcaaagcccaagccatgtaaaggttattca
gctgtaccattgaatgatgatcgaattttgatcattaaaaagggatctgctcctgatgac
tgcatatggtttcttgaggtggacactaaatatgttaaacagcagaaaaataatttggga
aaagaggttgttgcctggagtaagggtgtgagtggaaatgctgagaagccagttgtcatt
agtggtccttctggagtaggcaagggaacattaatatcaatgctcatgaaggaatttcca
tccatgtttggattttctgtaagccacacaacccgtgctccaagggccatggagaaagat
ggggtgcactaccatttcactgagagaagtgttatggagaaagagataagagaggggaag
ttccttgagtttgcttctgttcatggaaacctttatggaaccagtattgaagccgttgag
gtggtggcagatgcaggaaagagatgtattcttgacattgatgttcaaggggcgagatct
gtgagcgcaagctctctggaagcaattttcatctttatatgcccaccctcaatggaggag
cttgagaagcgacttcgtgcaaggggaactgaggcagaagagcagattctcaagcgactc
cgaaatgcaaaggcagaaatagaacaaggacaatcatcaggaatctttgagcacattttg
tataatgataaccttgatgagtgttatgagaacctaaagaaactcctgggattggatggt
accacagtggccatgcagaaatcaacatcccaagggatcaacctgcctgaggaccattca
atatcgaaagttgataataaaatcatcataaactgtggaacaccagaactagagaaagca
tcaaaaagctttatcatcttggatgcatcctcactcaaagggggggcacccggacggaca
aggggactcgatgtgcatgctattgactcgttttcagatggactgaatgggatcaatgag
ctgagctaa

DBGET integrated database retrieval system