KEGG   Ricinus communis (castor bean): RCOM_0753060Help
Entry
RCOM_0753060      CDS       T01087                                 

Definition
Aspartate carbamoyltransferase 2, chloroplast precursor, putative (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RCOM_0753060
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RCOM_0753060
Enzymes [BR:rcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RCOM_0753060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MCNYSSLFSKQTCSPKPISFSPVLRPLIRSGVRCSALEIGNADLLFSTGNRFQLEDVIEA
QQFDREILNAIFEVAREMEKIEKNSPGSQILKGYLMATLFYEPSTRTRLSFESAMKRLGG
EVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVMRHFESGAARRAATTACIPVINAGD
GPGQHPTQALLDVYTIDREIGKLDGIKVALVGDLANGRTVRSLAYLLAKYQDVKIYFVSP
DVVKMKDDIKDYLASRGVEWEESADLMEVASKCDVVYQTRIQRERFGERIDLYEEARGKY
IVDSDVLNVMQKHAVVMHPLPRLDEITVDVDVDPRAAYFRQAKNGLYIRMALLKLLLVGW
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaattattcaagtttgtttagcaaacaaacatgctctccaaagccaatatctttt
tctcctgtattaaggcctttaataaggagtggtgttaggtgtagtgcattggagattgga
aatgcagaccttttattttcaactgggaacaggtttcaacttgaggatgttattgaagca
cagcagtttgatagagagattctcaatgctatatttgaagttgcacgagaaatggagaag
attgaaaagaattctcctgggagtcaaattcttaagggttatttaatggctacccttttc
tatgaaccgtctacccgtactaggctttcttttgagtctgcgatgaaacggcttggtggt
gaggttttgactactgaaaacgcaagggaattttcttcagctgctaagggagagacactt
gaagacaccattagaactgttgaaggttattcggatatcattgttatgcgtcattttgaa
agtggcgctgcaagaagagctgctactactgcctgcattcctgttattaatgcaggggat
ggtcctggacaacatccaactcaggctcttttagatgtatatactatcgaccgagagata
ggtaaattggatggcatcaaagttgctcttgtgggagatcttgctaatggaaggacagtt
cgctcacttgcatacttgcttgccaaataccaggatgtaaagatctattttgtgtctcct
gatgtggtaaaaatgaaggatgatataaaagactacttggcatcgaggggagttgagtgg
gaagaaagtgctgatttaatggaagtggcgtcaaagtgtgatgttgtgtatcaaactcga
attcagcgagaaagatttggagagagaattgacctttacgaagaagctcgaggcaaatac
attgtggattctgatgtgttaaatgtgatgcagaagcacgctgtggtcatgcatcctctt
ccgaggctagatgagataactgtggatgttgatgtcgatccaagagctgcttattttaga
caagcaaagaatggtctctacatccgaatggcgcttctgaaacttctacttgttggttgg
tga

DBGET integrated database retrieval system