KEGG   Ricinus communis (castor bean): RCOM_0784670Help
Entry
RCOM_0784670      CDS       T01087                                 

Definition
4-diphosphocytidyl-2-C-methyl-d-erythritol kinase, putative (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCOM_0784670
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RCOM_0784670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 388 aa AA seqDB search
MASAHFLCNSHLFQPSCNSFAKTSLPSFKPAGSISFPRTQRIPFIKATKKQLEIVYDPDE
RLNKLGDEVDKIAPLSRLTLFSPCKINVFLRITDKREDGYHDLASLFHVISLGDTIKFSL
SPSKSTDRLSTNVAGVPLDERNLIIKALNLYRKKTGTDNFFWIHLDKKVPTGAGLGGGSS
NAATALWAANQFSGGLATEKDLLEWSSEIGSDISFFFSRGAAYCTGRGEIVQDIPSPVPL
DIPMVLIKPQEACPTGEVYKRFRLDQTSQVDPLTLLDKISKSGISQDVCINDLEPPAFEV
LPSLKRLKQRIVAASRGQYNAVFMSGSGSTIVGIGSPDPPQFIYDDDDYKDVFVSEANFL
TREANEWYKEPASTAACGTESDFSQSTE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctcatttcctctgcaacagccatctctttcaaccttcttgcaattccttt
gctaaaactagtcttccttcatttaagccagctgggtctatttcttttcctcgaacacaa
agaatcccatttatcaaagccaccaagaaacagctagagatagtgtatgatcccgatgaa
aggttaaacaagttaggagatgaagtagacaagattgctcctctttcaaggctcactttg
ttctctccttgcaagattaatgttttcctgcgaataactgataaaagagaagatgggtat
catgatttggcatctctctttcatgtaattagtctaggagatacaattaagttctcttta
tctccttcaaaatcaacagaccgtttatcaactaatgtggctggcgttccccttgatgaa
aggaatttgattattaaagcccttaacctatataggaaaaagacgggcactgacaacttc
ttttggattcatctagataagaaggtgcctactggggcagggcttggtggtggaagcagt
aatgctgcgactgcattgtgggcggcaaatcagttcagtggcggtcttgccactgagaag
gaccttctagaatggtcaagtgagattggttcagatatctccttctttttttcccgtgga
gcagcctattgtactggtcgtggtgaaattgtccaagatattccttctccagttcctctt
gacattccaatggttcttataaagccccaggaagcctgcccaactggtgaagtttacaag
cgctttcggttggatcaaaccagtcaagttgatcctttaacacttctggacaagatctca
aagagtggaatatctcaagatgtttgtataaatgacttggaacctcctgcatttgaagtt
ctcccatctcttaaaagattaaaacagcgtatagttgcagcaagccgtggacaatacaat
gcagtttttatgtctggaagtggtagtaccatagttgggattggttcgccggatcctcca
cagtttatttatgacgacgatgactacaaggatgttttcgtgtcagaggctaacttcttg
actcgtgaagcaaatgagtggtacaaagaacctgcttcaactgctgcttgtggcacagag
tctgatttttcccaatctacagagtga

DBGET integrated database retrieval system