KEGG   Ricinus communis (castor bean): RCOM_0838580Help
Entry
RCOM_0838580      CDS       T01087                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
rcu  Ricinus communis (castor bean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    RCOM_0838580
Exosome [BR:rcu04147]
 Exosomal proteins
  Proteins found in most exosomes
   RCOM_0838580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1705 aa AA seqDB search
MAAANAPITMKEVLTLPTIGISPQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQ
PLRRPITADSALMNPNSRILALKAQLPGTTQDHLQIFNIEMKAKMKSHQMPEQVVFWKWI
SPKMLGLVTQTSVYHWSIEGDSEPVKMFERTANLVNNQIINYRCDPSEKWLVLIGIAPGS
PERQQLVKGNMQLFSVDQQRSQALEAHAAAFAQFKVPGNENPSTLISFATKTFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQISHKYSLIYVITKLGLLFVYDL
ETASAVYRNRISPDPIFLTAEASSAGGFYSINRRGQVLLATVNEATIVPFVSGQLNNLEL
AVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQ
TGQTPPLLQYFGTLLTRGKLNAFESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIFIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRSDPQ
GAVNFALMMSQMEGGCPVDYNTITDLFLQRNLIREATAFLLDVLKPNLPEHSFLQTKVLE
INLVTFPNVADAILANGMFSHYDRPRIAQLCEKAGLYIRALQHYSELPDIKRVIVNTHAI
EPQALVEFFGTLSREWALECMKDLLLVNLRGNLQIIVQAAKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSSSEDPDIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVADLTHYLYSNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARY
VVERMDADLWEKVLNPENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYE
EAFAIFKKFNLNVQAVNVLLDNIRSIDRAVEFAFRVEEDAVWSQVAKAQLREGLVSDAIE
SFIRADDATQFLEVIRAAEDANVYHDLVRYLLMVRQKAKEPKVDSELIFAYAKIDRLSDI
EEFILMPNVANLQNVGDRLFDEALYEAAKIIFAFISNWAKLAVTLVRLKQFQGAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGYFNELISLMESG
LGLERAHMGIFTELGVLYARYRPDKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYI
QYDEFDNAATTIMNHSPEAWDHMQFKDVAVKVANVELYYKAVHFYLQEHPDLINDLLNVL
ALRVDHTRVVDIMRKAGHLLLVKPYMIAVQSNNVSAVNEALNQIYVEEEDYERLRESIDL
HDNFDQIGLAQKIEKHELLEMRRVAAYIYKKAGRWKQSIALSKKDNLYKDAMETASQSGD
RELAEELLVYFIDQGKKECFASCLFVCYDLIRVDVALELAWMNNMVDFAFPYLLQFIREY
TGKVDELVKDKIEAQKEVKAKEQEEKDVIAQQNMYAQLLPLALPAPPMPGMGGPTMGGGF
VPPPPMGGMGMPPMPPFGMPPMGSY
NT seq 5118 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgctaacgccccgatcaccatgaaagaagttttaactttaccaaccattggg
atcagtccacagtttataacgtttacgaatgtgacaatggagtctgataagtatatatgt
gtaagagaaacggcgccgcagaatagtgttgttattattgatatgaatatgccaatgcag
cctttaagacgtcctattactgctgattccgctcttatgaatcctaattctagaattctc
gctttgaaagctcaactcccaggaactactcaggatcacctacagatatttaacattgaa
atgaaagcgaaaatgaaatcacaccagatgcctgagcaggttgtcttttggaagtggata
agcccaaagatgttgggcctggtcacccagacatcagtttatcattggtcaattgaaggt
gattctgaacctgtcaagatgtttgagagaacagctaatttggtgaacaatcagataatc
aactacagatgtgacccttctgagaagtggttagttttgattggaatagctcctggttca
cctgagaggcaacaattggttaaagggaatatgcaacttttctctgtggatcagcagcgt
agtcaagcccttgaagcacatgctgcagcctttgcccagtttaaggttccaggaaatgag
aatccttcaactcttatttcatttgccacaaaaacttttaatgctggtcagattacatcg
aagttgcatgtcattgagctcggtgctcagccagggaagccatcattcacgaagaaacag
gccgatcttttcttccctccagactttgctgatgattttcctgttgcgatgcagatatcc
cacaaatacagtttgatatatgtgatcaccaaacttggattgctatttgtctatgatttg
gagacagctagcgctgtttacagaaatagaatcagtccagatcctatatttttgacagct
gaagcttcatcagctggaggcttttattccattaataggcgtggccaggtgttactggct
actgtcaacgaggcgacaattgttccatttgttagtggtcaattgaataatttggaactt
gctgtcaatcttgctaaaagaggaaaccttcctggtgcagagaatctggttgtccagcgt
tttcaagagctatttgctcaaacaaagtataaagaggctgctgagcttgctgcagagtct
ccacaaggaattcttcgaacacctgatacagttgcaaagtttcagagtgttcctgtgcaa
actgggcaaacaccccctctgctgcagtactttggaacacttctaacaagaggaaagcta
aatgcatttgagtcgttggaactgtcacgtcttgttgtcaatcaaaacaaaaagaatctc
ttggagaactggttggcggaggacaagttagagtgcagtgaggaacttggagatcttgtg
aagaccgtggataatgaccttgcactgaagatatttattaaagctagagctacaccaaag
gttgttgctgcttttgctgagagaagggagtttgacaagattttgatttactcaaagcag
gttgggtatactcctgactatttgttccttctgcaaacaattctgcgttcagatcctcag
ggagcagtgaattttgctttgatgatgtcccaaatggagggaggctgtcctgtggattac
aatactatcactgatctctttcttcagaggaacctgatccgtgaggcaacagcttttctg
ttggatgtgttgaagccaaatctaccagaacacagttttctgcaaacaaaggttcttgaa
atcaatttggtaacatttcctaatgtagctgatgctattctagccaatggaatgttcagc
cactatgatcgtcctcgtattgctcaactctgtgaaaaagctggtctatatatcagagcc
ctgcaacattattcagagttgccagatattaaacgtgtgattgtcaatacacatgcaata
gagccacaggcacttgtagagttttttggtactctttcacgagaatgggctttggagtgc
atgaaggatcttttactggtcaatcttagagggaaccttcagataattgtgcaggctgcc
aaggaatattgtgagcagttgggcgttgatgcctgcataaaactatttgagcaattcaag
tcttatgaggggctgtactttttcctggggtcatatttgagttccagtgaggatcctgat
atacacttcaagtacatcgaggcagctgctaaaactggacaaataaaggaggttgaacgt
gttactagagaatcaaatttttatgatgcagaaaagacgaagaactttctgatggaggcc
aaacttccagatgcaaggcctctgattaatgtttgtgatcgttttggttttgtggctgac
cttacacactacctctactcaaacaacatgcttcgctatattgaaggttatgttcaaaag
gtaaaccctggtaatgcaccgttagttgtgggccaactgcttgatgatgagtgccctgag
gacttcatcaagggcttgattctttctgttcgttcattacttcctgtggagccccttgtt
gaagaatgcgagaagagaaatcggcttcgattgctcactcagttcttggagcatcttgtg
agcgagggaagccaagatgtccatgtgcacaatgctctgggtaaaattattattgacagc
aataacaatccagagcacttcctgacaactaacccttactatgattctcgggttgtgggt
aaatattgtgagaaacgcgatcccaccctggctgttgtggcttaccggagagggcaatgt
gatgatgaacttatcaatgtgacaaataagaactctttgttcaaattacaagccagatat
gtggttgaaaggatggatgctgatctgtgggagaaggttcttaatccggagaatgaatat
agaagacagctcattgatcaagttgtatctactgctttgcctgaaagcaagagcccagaa
caagtttctgcagcagttaaggctttcatgactgctgatctccctcatgaattgattgag
cttcttgagaagattgtgcttcaaaactctgcgtttagtggaaatttcaatctgcagaat
cttcttattttgactgccattaaagcggatccatctagagttatggattacatcaacaga
ttggataattttgatggacctgctgttggggaagtggctgtagaggcccaactttacgag
gaagcatttgcaattttcaagaagttcaacttgaatgttcaggccgtaaatgtcttgttg
gataatattcggagcattgaccgtgcggtggaatttgcattccgtgttgaagaagatgca
gtttggagccaagtggcaaaggctcaacttagggaaggactggtgagcgatgcaattgaa
tcatttattcgtgctgatgacgctactcagttcttggaggtaattcgagctgctgaggat
gcaaatgtctatcatgacttggtgaggtacctcctgatggttaggcagaaggcaaaagaa
cccaaggtggacagtgagcttatttttgcatatgcaaagattgatcggctgagtgacatt
gaggaatttattctcatgccaaatgtagcaaatctccaaaatgttggtgatcgtttattt
gatgaagctctatatgaggctgcaaaaataatatttgcattcatatcaaactgggccaag
ttggctgtcacgcttgtgaggctgaaacaattccaaggtgctgttgatgcggcacggaaa
gccaacagtgcaaaaacatggaaggaagtttgctttgcttgtgttgatgctgaggagttc
cgtctggctcagatatgtggtctcaacatcattattcaggtggatgacttggaagaggtc
agtgaatactaccagaacagaggatacttcaatgagctgatctcgctcatggagagtggc
ttagggttggaacgtgcacatatgggtatattcacagagttgggagttttgtatgctaga
tatcgtcctgacaaacttatggagcacattaaattgttctctacccgtctgaatattcca
aagcttatacgtgcttgtgatgaacaacaacattggaaggagcttacctatttgtatatc
cagtacgatgaatttgataatgcggcaaccaccataatgaaccattctcctgaggcatgg
gatcacatgcaattcaaagacgtggcagtaaaggttgctaatgtggagctatattataag
gctgtgcatttctacttgcaagagcacccagatcttatcaatgatcttctcaatgtgctg
gctctccgtgtggaccatactcgtgttgtagacatcatgcgcaaggctggtcaccttctt
ttggtgaagccatatatgattgctgttcagagcaataatgtgtctgctgtgaacgaggcc
ttgaatcagatttatgtggaggaggaagattatgaaagattgcgtgagtcaattgatttg
catgacaactttgatcagattggcctagcacagaagattgagaaacatgagcttcttgaa
atgagacgtgttgccgcatacatttacaagaaggcaggaagatggaagcagtccattgca
ttgtcaaagaaagacaacctttacaaagatgcaatggagacagcatcgcaatctggtgat
cgtgaactagcagaggagttgcttgtttatttcattgatcagggcaagaaagaatgcttt
gcatcatgcctctttgtgtgttatgatttgattcgggtagatgttgctctggaacttgcc
tggatgaataatatggttgactttgccttcccatatctgctgcagttcatccgcgaatac
accggcaaagttgatgagcttgtgaaagacaaaattgaggctcaaaaggaggtaaaggct
aaagagcaggaagagaaggatgtgattgctcagcagaacatgtacgctcagttgcttcct
cttgctttgcctgcaccaccaatgccaggtatgggcggaccaacaatgggtggaggtttt
gtgccacccccgcctatggggggaatgggaatgcctccaatgccaccttttggcatgccg
ccaatgggcagttattga

DBGET integrated database retrieval system