KEGG   Ricinus communis (castor bean): RCOM_0880730Help
Entry
RCOM_0880730      CDS       T01087                                 

Definition
phosphofructokinase, putative (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rcu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rcu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rcu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rcu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rcu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rcu00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MASALPEDTDPALTSRNSEEPIPSHPFNLQKPSHLTDYLKGLKSCTNPLDNNPFYRPIEG
FYITQTDVILRQTILDFSTILSPRFAYHRAGPRKRIFFDPGTTCAAIVTCGGLCPGMNTV
IRELVVGLWELYGVRKIFGVVAGYRGFYSREPIELNPKLVHNWHKKGGTVLETSRGGFDL
HKIVDAIQSRGFNQVYIIGGDGTMRGAVKIFNEIRQRKLNIGVAGIPKTVDNDIGVIDKS
FGFQTAVEMAQQAINAAHVEAESAVNGIGLVKLMGRSTGHIALHATLSSRDVDCCLIPEI
DFYLEGKGGLFEFLEKRLQENGHAVLVVAEGAGQDKIPRTEAQKEERDESGNPVFLDVGA
WLKSELKNWWSRDHPTELFTVKHIDPTYMIRAVPANATDNLYCTLLAHSAIHGVMAGYTG
FVCGPINGNFGYIPLEEVAEAKNEVNLKDHKWAWVRSVTNQPGFVRSVLKVHHVGLICKR
LPSIVSLSYMTGTPRENNRVLKWKGILTSGIRERERKRGGLELQCNCEIRNPGWTLNCLV
MCNALLGSILLSAEETKLIGV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctttaccagaagataccgatcccgcccttacttctagaaactctgaagaa
cccatcccatcccatccatttaatctccaaaaaccttcccacttaacagactatcttaaa
ggcctcaaatcctgcactaatccattagacaacaatcctttctaccgtccaatagaaggc
ttctacatcacccaaacagacgtcattctccgccagaccatcctcgacttctctactatc
ttatctcctcgcttcgcctatcatcgggccggtccgcgtaagcgaatcttttttgatcct
ggaacaacgtgtgctgctattgttacatgtggtggactgtgtcccgggatgaatacggtg
atcagagaactggttgttgggctttgggagttgtatggagtgcgtaagatattcggggtg
gtggctggctatagaggattttattcaagagagccaattgagcttaatcctaagcttgtt
cataactggcataagaaaggtggtaccgttcttgagacttctagaggtggattcgatctt
cataagattgttgatgctattcaaagtcgtggctttaatcaggtctatatcattggtgga
gatggaacaatgcgtggtgctgtgaagatatttaatgaaattcgtcagaggaaattaaat
attggagttgctggaattcccaaaacagttgataatgatataggcgtcattgacaaatca
tttggattccagacagctgtggagatggcccagcaagcaatcaatgcagctcatgtggag
gcagagagtgctgttaatggtattggcctggtgaagctaatgggtcgaagcacagggcac
atagctctccatgcgacattgagtagccgtgatgtggactgctgcctaatacctgaaatt
gatttttacttggaaggaaagggagggctatttgaatttcttgagaagcgattacaagaa
aatggccatgcggttcttgttgttgctgagggggcaggacaggacaagataccgagaacc
gaagctcagaaagaagagagagacgagtcaggcaacccagttttcttagatgttggcgca
tggttgaagtcggagctgaagaattggtggtcaagagaccatccaaccgagttatttaca
gtgaagcatatagatcccacatacatgatacgagccgtccctgcaaatgctacagataac
ctatattgtactcttttggcacattcagctattcatggagttatggcaggttacactgga
tttgtttgcggtcccatcaatggcaactttggttatatcccactagaagaagttgcagaa
gctaaaaatgaagttaacctaaaggatcacaaatgggcatgggtgagatctgtcactaat
cagcctggttttgttaggagtgttttgaaagttcatcatgtgggtttaatctgcaagaga
ttaccgagtatagtttcactttcatacatgacaggcaccccgagggagaataatcgagtc
ctgaaatggaagggaattctcactagtggtattagagagagagagagaaagagaggagga
ctcgagctccagtgtaactgcgaaattcggaacccaggatggaccctgaattgtttggtt
atgtgcaatgctcttttgggttccatcctactgagtgctgaagaaacaaaactgataggt
gtctaa

DBGET integrated database retrieval system