KEGG   Ricinus communis (castor bean): RCOM_0900580Help
Entry
RCOM_0900580      CDS       T01087                                 

Definition
delta 9 desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rcu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rcu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MALVTSPVAKSKPYPFLPIRFSKALKLSSLVLNPSDQKNPKSVHLKTHCKRENSSLFACS
KKNTRNAAAQAIRGDDGSLFESEAEVKNGMIGRRILLSDVVVKRERNVFLGRKWNLLDIA
TAGVVLAMHLLSLFAPFYFNWSAFWVAFGLYVITGLLGITLSFHRNLSHRSFKLPKWLEY
LFAYCGVQALQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWYSHMSWLFDTNSIIKRCG
EPNNVGDLEKQPFYKFIQQTYILHPIALATLLYAVGGFPFLVWGMGVRIIWVFHITWLVN
SACHVWGKQEWNTGDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVR
LLEAIGLATDVKVPNETQKQKKAFNN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctctagtcacctctccagtagccaaatccaaaccctaccctttcttgcctattcgc
ttctcgaaagcattaaaattatcttctttagtcctaaatccttctgatcagaaaaatcca
aaatccgttcatctcaaaacccactgcaaacgagaaaattcgagtctttttgcatgttca
aagaagaatacccgcaatgcagctgctcaggcaataagaggtgatgatggttctttattt
gagtcagaggcagaggtaaagaatggcatgattggtaggagaattctgttatcggatgtg
gtggtgaaaagggaaaggaatgtgtttttggggaggaaatggaatttactagatatagct
acggctggtgttgtattggcaatgcatttgcttagtttgtttgctcctttttatttcaat
tggagtgctttttgggttgcttttggactctatgttatcacaggacttctgggtattact
ctttcttttcatagaaatctttctcataggagtttcaagttgccaaaatggctcgagtac
ctttttgcatattgtggagttcaagcacttcagggaaatccaattgattgggttagcacg
cataggtatcaccatcagttttgtgattctgagagagaccctcatagccccattgaaggg
ttttggtacagtcatatgagttggctatttgataccaattctattattaaaaggtgtgga
gagccgaacaatgttggggatttagagaagcaacccttttataagtttatccaacaaaca
tacattctgcatccaattgcccttgcaactctattatatgcagtaggagggtttcctttc
ctagtctggggaatgggagtgaggattatatgggtcttccacatcacttggctagtaaac
tcagcttgtcatgtatggggaaagcaagaatggaatactggtgatctgtccaggaacaat
tggtgggtggcactgcttgcatttggagagggttggcacaacaatcaccatgcttttgaa
tactcagctagacatggcctagaatggtggcagatcgacatgacttggtatgttgtgagg
cttcttgaagctattggattggcaactgatgtgaaggtaccaaatgagacacaaaagcaa
aagaaggcattcaacaattga

DBGET integrated database retrieval system