KEGG   Ricinus communis (castor bean): RCOM_0900580Help
Entry
RCOM_0900580      CDS       T01087                                 

Definition
delta 9 desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RCOM_0900580
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RCOM_0900580
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RCOM_0900580
Lipid biosynthesis proteins [BR:rcu01004]
 Desaturase
  First
   RCOM_0900580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MALVTSPVAKSKPYPFLPIRFSKALKLSSLVLNPSDQKNPKSVHLKTHCKRENSSLFACS
KKNTRNAAAQAIRGDDGSLFESEAEVKNGMIGRRILLSDVVVKRERNVFLGRKWNLLDIA
TAGVVLAMHLLSLFAPFYFNWSAFWVAFGLYVITGLLGITLSFHRNLSHRSFKLPKWLEY
LFAYCGVQALQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWYSHMSWLFDTNSIIKRCG
EPNNVGDLEKQPFYKFIQQTYILHPIALATLLYAVGGFPFLVWGMGVRIIWVFHITWLVN
SACHVWGKQEWNTGDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVR
LLEAIGLATDVKVPNETQKQKKAFNN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctctagtcacctctccagtagccaaatccaaaccctaccctttcttgcctattcgc
ttctcgaaagcattaaaattatcttctttagtcctaaatccttctgatcagaaaaatcca
aaatccgttcatctcaaaacccactgcaaacgagaaaattcgagtctttttgcatgttca
aagaagaatacccgcaatgcagctgctcaggcaataagaggtgatgatggttctttattt
gagtcagaggcagaggtaaagaatggcatgattggtaggagaattctgttatcggatgtg
gtggtgaaaagggaaaggaatgtgtttttggggaggaaatggaatttactagatatagct
acggctggtgttgtattggcaatgcatttgcttagtttgtttgctcctttttatttcaat
tggagtgctttttgggttgcttttggactctatgttatcacaggacttctgggtattact
ctttcttttcatagaaatctttctcataggagtttcaagttgccaaaatggctcgagtac
ctttttgcatattgtggagttcaagcacttcagggaaatccaattgattgggttagcacg
cataggtatcaccatcagttttgtgattctgagagagaccctcatagccccattgaaggg
ttttggtacagtcatatgagttggctatttgataccaattctattattaaaaggtgtgga
gagccgaacaatgttggggatttagagaagcaacccttttataagtttatccaacaaaca
tacattctgcatccaattgcccttgcaactctattatatgcagtaggagggtttcctttc
ctagtctggggaatgggagtgaggattatatgggtcttccacatcacttggctagtaaac
tcagcttgtcatgtatggggaaagcaagaatggaatactggtgatctgtccaggaacaat
tggtgggtggcactgcttgcatttggagagggttggcacaacaatcaccatgcttttgaa
tactcagctagacatggcctagaatggtggcagatcgacatgacttggtatgttgtgagg
cttcttgaagctattggattggcaactgatgtgaaggtaccaaatgagacacaaaagcaa
aagaaggcattcaacaattga

DBGET integrated database retrieval system