KEGG   Ricinus communis (castor bean): RCOM_0901410Help
Entry
RCOM_0901410      CDS       T01087                                 

Definition
formamidopyrimidine-DNA glycosylase, putative (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    RCOM_0901410
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     RCOM_0901410
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     RCOM_0901410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MPELPEVEAARKAIEENCLGKKIKKAIIASDAKVIDGVSPSDFEAALVGKTLISAHRKGK
NLWLQLDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVNDTDEWPSKYSKLFVELDDGLEL
SFTDKRRFAKVRLLNNPVSVPPISELGPDALLQPMAVDEFYKSLCKKKMPIKALLLDQSF
ISGIGNWIADEVLYQARIHPQQSASSFTKESCATLLKCIKEVIEKAIEVEADSSQFPNSW
IFHSREKKPGKAFIDGKKIDFITSGGRTTAYVPELQKLSGNQISKRRNSEDNNDDNGVEG
EDAASNAASLEDGAAKKAKPKRELKPRGRGKKPPPEQKTKATDADEDNDEAACNANNEDD
QVKEEDQKKKEQSASNDKQPNGKKRSDKTVTDHNNKKPKKTVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccagaggttgaagcggcgaggaaagcaatagaggagaactgcttaggc
aagaagatcaagaaagctatcatagccagtgatgctaaagtcattgacggagtctctccc
tctgatttcgaagctgctcttgttggcaaaaccctaatttctgctcatcgtaagggcaaa
aacctgtggctccagctcgattctcccccttttccttcgtttcagtttgggatggctggt
gctatatatattaaaggagttgctgttaccaaatataaaaggtctgctgtgaacgacact
gatgagtggccatccaaatattcaaagctatttgttgaactagatgatggtctggagctg
tctttcactgataagaggcgatttgctaaagttcgcttgctcaacaatcctgtgtctgtg
cctccaatatctgagcttggccctgatgcactattgcagccaatggcagttgatgagttt
tataaatcattgtgcaagaagaaaatgcctatcaaggctctcttacttgatcagagtttt
atttctggtattggaaactggattgcagatgaagtgctataccaagccagaattcatcca
cagcaaagtgcttccagctttaccaaagaaagttgtgcaacattactcaagtgcatcaag
gaggtaattgaaaaagcaatagaagttgaggcagatagtagtcaattccccaatagttgg
attttccattctcgagaaaagaagcctgggaaggcttttattgacgggaaaaaaattgat
tttatcacttccggtggtaggacaacagcttatgtaccagagttgcaaaagctgagcgga
aaccaaatttcaaagagaagaaacagtgaggataataatgatgataatggagttgaaggt
gaggatgctgccagtaatgctgcaagcttggaagatggagctgccaagaaggcaaaacca
aagagagaattgaagcctagaggccgtggtaagaaacctccaccagaacagaagactaag
gcaactgatgctgatgaagataacgatgaagctgcttgtaatgctaataatgaggatgat
caggtaaaagaagaggatcaaaagaagaaagaacagagtgcgagcaatgataaacagccg
aacgggaagaagagatccgacaaaacagtaactgatcacaacaataagaagccaaagaaa
acagtgaagtag

DBGET integrated database retrieval system