KEGG   Ricinus communis (castor bean): RCOM_0901490Help
Entry
RCOM_0901490      CDS       T01087                                 

Definition
glycerol kinase, putative (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rcu00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:rcu04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MAKQEPAFIGAIDQGTTSTRFIIYNRHANSIGSHQVEFTQFYPQAGWVEHDAMEILESVK
VCMAKAVDKATADGHNVDGLLKAIGLTNQRETTVIWSKSTGVPLYNAIVWMDVRTSSICR
KLEKELPGGRTHFIETCGLPLSTYFSAVKILWLMENVDAVKEAIKKGDALFGTIDSWLIW
NLTGGVKGGLHVTDVSNASRTMLMNIKTLEWDKPTLNTLGIPAEILPKIISNSEVIGKIA
KGWPVTGIPIAGCLGDQHAAMVGQGCKRDEAKSTYGTGAFILLNTGDHIVPSKHGLLTTL
AYKLGPKAPTNYALEGSIAIAGAAVQWLRDGLELISSASEIEELAKQVDSTGGVYFVPAF
NGLFAPWWRDDARGVCIGITRYTNKSHIARAVLESMCFQVKDVLDSMHKDREEKHKDTKR
EFLLRVDGGATINNLLMQIQADLVGHPVVRPSDIETTALGAAYAAGLAVGIWTEKEIFAS
GEKAKTDTIFCPKLDEELRKKKVESWCKAVERTFGLADLSI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaggaaccagctttcattggagccattgatcaaggcacaactagcaccaga
ttcataatctacaatcgccatgccaactctattggatctcaccaggttgaattcacccag
ttctaccctcaagccggatgggtggagcatgatgctatggagatacttgagagcgtcaag
gtgtgtatggccaaggcagtggataaagctactgctgatggacataatgttgatggttta
ttgaaggctattgggctaactaatcagagagagaccactgttatttggagcaaatcaact
ggtgttcctctttataatgccattgtttggatggatgttcgtaccagttctatttgcagg
aaattggagaaagaattaccaggtggaaggactcatttcattgagacttgtggtctgcca
ttaagtacttatttcagtgcagtgaagatactgtggttgatggaaaatgttgatgctgtt
aaagaggctatcaagaaaggggatgctctgtttggaactatagactcttggttaatatgg
aatttaactggtggagtgaagggtggcttgcatgtcactgatgtttctaatgcatctcga
accatgctcatgaatatcaaaacccttgaatgggataaacctacattgaatactttggga
attcctgctgaaattctgcccaaaattataagcaactctgaggttattggaaaaattgca
aaggggtggccagttactggcattccgattgcagggtgtcttggagaccaacatgctgca
atggtaggacaaggatgcaaaagagatgaggccaaaagcacttatgggactggtgctttc
atacttctcaacacaggtgatcacatagttccatcaaagcacgggcttttaactactttg
gcttataagcttggtccaaaagcgcctaccaattatgctttagagggttcaattgctatt
gctggagctgcagttcaatggcttagagatggccttgagctaattagtagtgcaagtgaa
atcgaggaacttgccaagcaggttgactcgactggtggtgtttattttgtacctgctttt
aatggactgtttgccccatggtggcgtgatgatgcccgtggggtctgcattgggatcaca
aggtatactaataagtcccacattgctcgagctgtgcttgagagcatgtgtttccaagtt
aaagatgtattggattcaatgcacaaagatagagaggaaaagcataaggacactaagagg
gagttcctgctaagagtagatggtggtgcaactattaacaacctcttgatgcagattcag
gcagacttggtgggacacccagttgtgaggccatctgatatagaaacaacagctcttgga
gcagcctatgctgctggtttggctgttgggatttggacagagaaggagatttttgcttca
ggagaaaaggctaagacagataccatcttctgtccgaaattagatgaagaactgagaaag
aaaaaggtggaatcttggtgcaaagctgttgaaagaacttttggcttggctgatctttca
atatga

DBGET integrated database retrieval system