KEGG   Ricinus communis (castor bean): RCOM_0903560Help
Entry
RCOM_0903560      CDS       T01087                                 

Definition
malonyl-CoA decarboxylase, putative (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rcu  Ricinus communis (castor bean)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rcu00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:rcu00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:rcu04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MNKKGLAILMRTRMRPSNDPTSPLNNKNKVDQMITNSQGTQFGSTVSQHAAQEGAKMVNT
FTSKERDFDSVRASMHSAISLNKTDVLDAVLNDFAEGYLSFSLENRRKLLFMLAKVYDLN
RAQVHDLIKQYLGLEPPCCVAGETESDSVEAEATLSSFYRIERNLRQALKPTYDVLFERL
NNHPGGLKFLSIIRADIVSLLAEENAACLRALDSYLKEKLSTWLSPAALELHQITWDDPA
SLLEKIVAYEAVHPICNLLDLKRRLGVGRRCFGYLHPAIPGEPLIFIEVALLKNVAQTIQ
EVLWDNPPIPEPDATCALFYSISSTQPGLAGINLGKFLIKRVITLVKRDMPHISIFATLS
PIPGFLRWLLSKLASQSILAEVENMSQSSSTGSVSAFRENILEPDEERSLMNCCQEAFPG
KNGMEVMLKLLTSTKHEWTNSAELLSALKPPLMRLCARYLLQEKKRGKALDSVANFHLQN
GAMVERINWMADRSEKGLQQSGGIMVNYVYRVHKIEEYSESYFSAGHIHASNGICRYNIV
ISCP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaggtttagccattttaatgcgaactagaatgcgaccttccaacgatcct
acctcacctctcaataacaagaacaaggtcgatcaaatgataaccaattcccaaggtacc
caatttggttctactgtttctcaacatgctgcacaggaaggagctaaaatggtcaatact
tttacttccaaagagagggactttgattctgtccgtgcttctatgcattcagccatttca
ttgaataaaactgacgttcttgatgcggtgcttaatgatttcgctgagggttatctaagc
ttttctcttgaaaatcgccgcaaattattgtttatgcttgccaaagtctatgatctcaac
agggctcaagttcatgacctcatcaaacaatatcttggacttgaacctccttgttgtgtt
gctggtgaaactgaatccgatagtgttgaagccgaagctactctttcttctttctatcgc
attgaacggaatttgagacaagctcttaagcctacatatgatgtcctttttgaacgtctc
aacaatcatcctgggggattgaagttcttatccattattcgagctgacattgtctctctt
ctcgcagaagagaatgctgcatgtttgcgggcactagattcctacttaaaggaaaaactc
agtacttggcttagtcctgctgcattggaacttcaccagattacatgggatgatcctgct
tctttgctggagaaaattgtggcttatgaggctgtacatccgatctgcaatctcttagat
cttaaaagaaggttgggtgttggtcgtcgttgtttcggatatttacatccagcaatacct
ggtgagccccttattttcatagaagttgcccttctaaagaatgtggctcagacaatacag
gaagttttatgggataatcctcctatacctgaacctgatgcaacttgcgcactattttat
tctatatcgtcaactcagcctggcttggcagggatcaacctgggaaagtttcttatcaaa
cgtgtcattacgctggtgaaaagagatatgccacatatatctatatttgcaacattaagc
ccgattcctggattcttgcgatggctgctatctaagttggcatctcagtcaatccttgct
gaagtggagaacatgtcacaatcatcttcaactggatcagtttctgcgtttagggagaac
atccttgagccagatgaagaaagatcacttatgaattgttgtcaggaggcttttcctgga
aaaaatggcatggaagtgatgttaaagttgttgacatcaacaaaacatgaatggaccaac
tcagctgaattgctttcagcactgaagccccctctgatgcgactatgtgccaggtacctt
ctacaagagaaaaagagaggaaaagctctggattctgttgcaaattttcacttgcaaaat
ggagcgatggttgaaagaataaattggatggcagaccgctcggagaaaggccttcagcaa
agtggaggtatcatggtgaactatgtttacagggttcataaaattgaagaatattctgag
tcatatttcagtgcagggcatatacatgcttcaaatggcatctgccgatacaatatcgta
atttcttgtccataa

DBGET integrated database retrieval system