KEGG   Ricinus communis (castor bean): RCOM_0905390Help
Entry
RCOM_0905390      CDS       T01087                                 

Definition
tryptophan synthase beta chain, putative (EC:1.3.1.74)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rcu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rcu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rcu00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MDISCSIQTSFFNGKLQNLRSAVRYVAAQRRTANIRVVCAKTLTSENPNSSKLDVVKPKI
KILVPNNLPLPSPGKFGRFGGKFVPETLITCLRDLEAVFNSVLKDPEFQEELATALRDYV
GRETPLYYAERLTNHYKNEKGEGPEIYLKREDLNHTGAHKLNNAIAQAMIAKRMGMETVV
AATGAGQHGVATAAACAKLSLQCTVFMGTSDMERQSSNVLLMKLLGAEVKAVAGNFKDAS
SEAIREWVGNLQTSYYLAGTVVGPHPSPSMVREFQSVIGKETRRQAMEKWGGKPDVLVAC
VGSGSNALGLFNEFIGDEDVRLIGVEAAGFGLNSGKHAATLAKGEVGVYHGAMSYLLQDE
EGQIIGPYSIGVGLEYPGVSPELSFLKEIERAEFYSATDEEAINAYQRLCKLEGIIPALE
ASHALAFLEKLCPNLSNGTKVIVSCSGRGDKDAATVLNYKQDS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggatataagttgcagtatccaaacctctttctttaatggtaaactgcaaaatttacgg
tcagctgttcgttatgtggcagctcagagaagaactgcaaatatccgtgtagtttgtgct
aaaactttaacaagtgaaaatcccaactccagtaaattggatgttgtaaagccaaagata
aagatcctagttccaaataatttaccactacccagccccggaaaatttgggaggtttgga
ggcaagttcgtgcctgagactctcattacgtgcttgagggatcttgaagctgtattcaat
tctgttttaaaagaccctgaatttcaggaggagcttgcgacagcactaagagactacgtg
gggagggagactccgctgtattacgcagagaggctcacgaatcactacaagaatgaaaaa
ggagaaggacctgaaatttacttgaagagagaagatcttaaccatacaggagctcataaa
ttgaacaacgcaattgctcaggcgatgattgccaaacgtatgggcatggaaactgttgtg
gcggccactggtgccggtcaacatggcgttgcgactgctgctgcatgtgctaagctttct
ttgcagtgtactgttttcatgggtacttcggatatggaaaggcaatcctcaaacgtactc
ctgatgaaacttttgggcgctgaggttaaagcagtggcaggaaattttaaggatgcaagc
tcagaagcaataagagaatgggtagggaatttacagacgagctactacttggcagggact
gtagtgggtcctcatccaagtccaagcatggtccgggagtttcagtctgtaataggaaag
gaaacaagaaggcaagcaatggagaaatggggtgggaagccagatgtactggtagcatgt
gtagggagtgggtcaaatgcattagggttgttcaacgaattcataggagatgaagatgtg
agattgataggtgttgaggctgctggatttggtttaaacagtgggaaacacgcagcaact
ttagctaaaggagaagtgggtgtgtatcatggagctatgagttatttgttgcaagatgag
gaaggtcaaattataggtccatattctattggcgtggggttggaatatccaggagttagt
ccagaattgagcttccttaaagaaatagaacgtgcggaattttattctgctaccgacgaa
gaagctataaatgcataccagaggctgtgtaaattggaaggtataattccagctttggag
gcttctcatgcactcgcatttctggagaaactttgtcctaatttatccaatggcaccaaa
gtcattgtcagctgtagcggtcgtggggataaagatgctgccacagtcttaaactacaag
caagactcataa

DBGET integrated database retrieval system