KEGG   Ricinus communis (castor bean): RCOM_0908820Help
Entry
RCOM_0908820      CDS       T01087                                 

Definition
DNA-repair protein XRCC4, putative
Orthology
K10886  
DNA-repair protein XRCC4
Organism
rcu  Ricinus communis (castor bean)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    RCOM_0908820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
METSKITTEAETARHTCLKLEITEPIFVKGTWFDSHFHLSITDGLNAWVCNATEGQVKER
AAQWDQPVSEYINLAEHYLGFQQPGSIYRFADAGDSHKRLSWTFEKEGTKLEWRWKCQPS
PDNKMTTAGILDFLMDANIRLSEEVVKKTHSFERLKEEADKCLTQSERFAGEKTEFESSI
YAKFLAVLNSKKRKLRQLRDQLSKKEASGKLPQEEEEESTDKTESFEEDSSDGDKSEEEP
PEKVTGTSEDKPSSRGRGRKRITRK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggagacatcaaagataacaacagaagcagaaacagcgaggcacacgtgtctaaagctc
gaaatcaccgaaccaatattcgtaaaagggacatggttcgactcccacttccacctctcc
atcaccgatgggctcaacgcttgggtctgcaacgcgacagaagggcaagtgaaagagaga
gcagcgcagtgggaccagccggtgtctgaatacatcaatttagccgaacattacttaggg
tttcagcagcccggttcaatctatcggttcgctgatgccggtgatagccataaacgcttg
tcatggacatttgaaaaggaagggacaaagctagaatggagatggaaatgccaaccatct
cctgataataagatgactactgcaggaatcttggactttctcatggatgctaatatcagg
ctcagtgaagaagttgttaagaagactcattcgttcgagcggttaaaggaggaagctgac
aagtgtttgacacaaagtgagagatttgccggtgagaaaactgaatttgaatcttcaata
tatgcaaagtttcttgcagtcttgaattcaaagaaacgaaagctcaggcagcttcgagat
cagctctcaaagaaggaagcttcaggaaaattgccacaagaagaggaagaagaatccaca
gacaaaactgagagttttgaagaagatagtagtgatggtgacaagagtgaggaagaacct
ccggaaaaagttacaggaacttcagaggataaaccatcaagcagggggcgtggtagaaag
aggatcacacgcaagtag

DBGET integrated database retrieval system