KEGG   Ricinus communis (castor bean): RCOM_0911070Help
Entry
RCOM_0911070      CDS       T01087                                 

Definition
acireductone dioxygenase, putative
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RCOM_0911070
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     RCOM_0911070
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     RCOM_0911070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 200 aa AA seqDB search
MVAPNKDPREEVIQAWYMDTSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLNADNYETD
EELKKIREERGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRD
HNDRWIRVWVKKGGMIVLPAGIYHRFTLDTDNYIKAMRLFVGDPIWTPFNRPHDHLPARK
EYIKAFVQKEVDHQAVDATA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggttgccccgaataaggatcctagggaagaagtcattcaggcatggtacatggatact
agtgatgaggaccagagactgccccatcacaaggatcctaaggaatttgtgtccttggac
caactttctgagcttggagtacttagttggagactaaatgcagacaactatgaaacagat
gaggagttgaagaagatccgtgaagaacgtggatactcctacatggacttttgtgaagta
tgcccagagaagcttccaaattacgaagaaaagataaagaacttttttgaagaacatctt
cacactgatgaggagatacgctactgcgtagctggaagtggttattttgatgtcagggat
cataatgatcgctggattcgtgtctgggtgaagaaagggggaatgattgtcttacctgct
ggaatttatcaccgatttacattggatacagacaattacatcaaggcaatgcgacttttt
gtgggtgatccaatttggactccattcaaccgtccccacgatcatctaccagcaaggaag
gagtatatcaaagcttttgtgcagaaggaagttgatcatcaggctgttgatgccaccgca
tga

DBGET integrated database retrieval system