KEGG   Ricinus communis (castor bean): RCOM_0920330Help
Entry
RCOM_0920330      CDS       T01087                                 

Definition
Eukaryotic translation initiation factor 3 subunit, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
rcu  Ricinus communis (castor bean)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:rcu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 720 aa AA seqDB search
MADVMMMNDIDERAAAAGIDLSQLDLSSIHLSPGENFGIISDDEDVHQREQLDFEAGFNN
IIVVDNLPVVPKEKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETQKTLGYCFIEYNTPQ
EAELAKEKTNGYKLDRAHIFAVNMFEDFDRFMRVPDEWAPPEFRPYVPGENLQHWLTDEK
ARDQFVIRAGSDTEVFWNDARQLKPDPVYKRAYWTESFVQWSPLGTYLATVHRQGAAVWG
GASAFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPHDANRIVINIFDVRTGKVMRD
FKGSADEFAIGGTGGVAGVSWPIFRWGGGKDDKYFARMGKNMISVYETETFSLIDKKSMK
VENIMDFSWSPTDPILALFVPELAGGNQPARVSLVQIPSKEEMRQKNLFSVNDCKMYWQS
NGDYLAVKVDRYTKSRRTTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFA
VIHGDSPRPDVSFYSMRTAHNTGRVSKLTTLKGKQANALFWSPAGHYLILAGLKGFNGQL
EFYNVDELETMATTEHFMATDIDWDPTGRYVATSVTSVHHEMENGFNIWSFNGKLLYRIL
KDHFFQFLWRPRPPSFLSAEKEEEIANNLKKYSKKYEAEDQDVSLQLSEQDREKRRMLKD
DWEKWVNEWKLQHEEEKLERQKLRDGEASDEEEEYEAKEVEVEELLDVSEEVLSFEFGQE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgttatgatgatgaatgacatagatgagcgtgctgcggcagccggaatcgat
ctctcgcagctcgatctcagctccattcatctttctcctggtgaaaatttcggaatcatc
agtgatgatgaagatgttcaccaacgagagcagctggattttgaagctggatttaataat
attattgttgttgataatcttccagttgttcccaaggaaaaattcgagaagcttgaaggt
gttattcggaaaatttatagtcagattggtgtaattaaggaggatggactttggatgcct
gttgatcctgaaacacaaaaaacattaggttactgcttcattgagtataacacacctcag
gaggctgagttagccaaggagaagacaaatggttacaagttggacagagcacatattttt
gctgtcaatatgttcgaggattttgatagatttatgagagttccagatgagtgggctcct
cctgaattcaggccttatgttcctggggaaaatcttcagcattggcttactgatgaaaaa
gcacgagaccagtttgtaattcgggctggctcggataccgaggttttctggaatgacgca
agacagttgaagcctgatcctgtttacaagcgtgcttattggacagagagttttgtgcag
tggtccccacttgggacttacttggcaacagttcacaggcagggtgctgctgtctggggt
ggtgcaagtgcctttaataggcttatgcgttatgctcatccccaggttaaactgatcgac
ttttcacctggtgagaaatatttggttacctacagcagccatgaacctagcaatcctcat
gatgcaaataggattgtaataaatatttttgatgtaagaactggcaaagtgatgagagat
ttcaagggaagtgctgatgaatttgccattggaggaactggtggtgttgcaggagtatcc
tggcccatatttaggtggggtggtggaaaagatgacaagtactttgccagaatggggaaa
aatatgatatctgtttatgaaactgagaccttcagtcttattgacaagaagtctatgaag
gttgaaaacattatggatttcagttggtcaccaactgatcccattcttgcactctttgtt
cctgagcttgctggaggaaaccaacctgctagggtttcccttgttcaaattcctagtaaa
gaggaaatgaggcagaagaatctttttagtgttaatgattgcaaaatgtactggcaaagc
aatggggactatcttgctgtaaaggttgatcgctacaccaaatcaaggaggaccacatac
acaggatttgagcttttccgaataaaagaacgagatatacccatcgaggtattggagctt
gataacaaaaatgataaaattattgcctttgcttgggagccaaagggtcacaggtttgcg
gttattcatggggatagcccaaggcctgatgtaagtttttactcaatgaggacggcccat
aatactggtcgagtttcgaagctcactactctcaaaggcaaacaagcaaatgctcttttc
tggtcacctgctggccactatttaatacttgctggacttaagggtttcaatggacagtta
gaattttataatgttgatgagctggagaccatggcaacaactgaacattttatggccaca
gatattgattgggatcctactggaaggtatgttgcaacttcagtgacttcagttcaccat
gaaatggaaaatggattcaatatctggtcgttcaatggcaagctactttatcgaatcctc
aaggatcatttcttccagttcctgtggcgcccaaggccaccatcctttttgagtgctgaa
aaggaggaagagatagcaaacaatttgaagaagtacagtaagaaatatgaggcagaggat
caggatgtttcattgcaattgagtgagcaagatcgtgagaaacggagaatgttgaaggat
gattgggagaagtgggtcaatgagtggaaactacagcatgaagaagaaaaattggagagg
cagaaattaagggatggagaagccagtgatgaagaagaagagtacgaggctaaagaagta
gaagttgaggaattgttggatgtgtcagaggaggttctttcttttgaatttggacaggag
taa

DBGET integrated database retrieval system