KEGG   Ricinus communis (castor bean): RCOM_0920780Help
Entry
RCOM_0920780      CDS       T01087                                 

Definition
glutathione peroxidase, putative (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rcu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rcu00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MASVPLSSPFQSLTHFKINPNSVSSSPSMAFFVPSVKSSLGSSKSAFLQHGFSLQLATSS
GFFSKARSFCVSARAATEKSIHEYTVKDIDGKDVPLSKFKGKALLIVNVASKCGLTSSNY
TELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKNFACTRYKAEFPIFDKVDVNGPN
TAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPFQIEVYFFFYFKNLD
IFGTLVPLNYHEQYEGVMPLWSGCR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgtccccctctcttcgccttttcagagtttaacccacttcaaaattaatccc
aattctgtttcttcctctccttccatggctttctttgttccatcagtcaaatcctcactc
gggtcctctaaatcagcttttttacaacatgggttctctttgcaattggcaacttcttct
gggttcttctcaaaggctcgatctttttgtgtttctgcaagagcagctactgagaaatct
atccatgagtacactgtaaaggacattgatgggaaagacgtaccgctcagcaaatttaaa
gggaaagctttattgattgtcaatgttgcttcaaaatgtggtttgacatcctcaaattac
acagaactctcacatctttatgagaagtacaagactcaaggatttgaaattctagctttc
ccttgcaatcaatttggagggcaagagcccgggtcaaatcctgagataaaaaattttgct
tgtaccagatacaaagcagaatttccgatattcgataaggtggatgtgaatggaccaaat
acagctccagtttatcaatttctcaagtcaagtgctggaggatttttaggtgacctgatc
aaatggaactttgagaagttcttggtggacaagaatggtaaggtcgtggagagatatcca
ccgacaacatcgcctttccaaatagaggtatatttctttttttactttaaaaatttggac
atctttggcacattggttcctctgaattaccatgaacagtatgaaggggtgatgcctttg
tggtcaggatgcaggtag

DBGET integrated database retrieval system