KEGG   Ricinus communis (castor bean): RCOM_0920900Help
Entry
RCOM_0920900      CDS       T01087                                 

Definition
Enoyl-CoA hydratase, mitochondrial precursor, putative
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rcu01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rcu00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:rcu00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:rcu00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 406 aa AA seqDB search
MQRVNQLVKVRHLVNSRIGFLSTPREFSALPNYAQNDDLQDQVLVEGRAKSRAAILNRPS
SLNSLTEPMLARLKRLYESWEENPDIGFVLMKGSGRAFCSGADVVSLSELVNEGRVDECK
SFFQILYKFAYLQGTYLKPHVAILDGITMGCGAGISLPGMFSIVTDKTVFAHPEAQMGFH
PDAGASYYLSRLPGYLGEYLALTGDKLNGAEMIACGLATHYTLNARLALIEERLGRLVTD
DRTVIETSLAQYGDLVYPDKTSVLHKIETIDKCFSHDTVEEIIDALENEAASSYDAWLKA
ALTKIKEASPLSLKVVLQSIREGRFQSLDKCLAREYRISLTGVSKRVSNDFCEGVRARLV
DKDFAPKWDPPSLREVSEDMVDCHFSPLSELESELELPTAIRESYM
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagtaaaccaattggtaaaagtaagacatttagtcaattcaagaattgggttc
ctttccacaccaagagaattttctgctctaccaaactacgctcaaaatgatgatcttcaa
gaccaggttttggttgaaggaagagctaaatcaagagcagccattcttaataggccttct
tctctcaactctctcactgagcctatgctagcaaggctcaagagattgtatgaatcatgg
gaagaaaatccagatattggatttgtcttaatgaagggtagcggcagggcattctgttct
ggtgctgacgttgtatccctcagtgagttagttaatgaaggtagagttgatgagtgcaaa
agcttttttcagatattatataagtttgcctacctacaaggaacatacttgaagccacat
gtggctatcttggacggtatcacaatgggatgtggagctggaatttcactcccaggaatg
tttagtattgtaactgataaaactgtttttgcgcatcctgaggctcaaatgggtttccat
cccgatgcaggggcttcctattatctttctcgcctccctggttacttgggggaatactta
gctctaacaggagataagcttaatggtgcagaaatgattgcttgtgggcttgctacccat
tacacattaaacgcgagactggctttgatcgaggaacgccttggaagattggtcacagat
gatcgtactgtcattgagacttctcttgcacaatatggtgatcttgtctatccagataag
acaagtgtccttcacaagattgagaccattgataaatgtttcagccatgatacagtagag
gaaataattgatgcattggaaaatgaagcagctagctcttatgatgcatggttgaaagca
gcacttacaaaaataaaagaagcctccccgctaagcttaaaagttgtcttacaatctata
cgagaaggtagatttcaatctctggataagtgcctagctcgtgaatatcgaatttccctc
actggtgtctccaaaagggtctccaatgacttctgtgagggagtccgagctcgattagtg
gataaggattttgctccaaagtgggatcctcctagtttaagagaagtaagtgaagacatg
gtggactgccatttctctccgctaagcgagcttgaatctgagctagagctgcccacagca
atacgagaatcttatatgtga

DBGET integrated database retrieval system