KEGG   Ricinus communis (castor bean): RCOM_0924650Help
Entry
RCOM_0924650      CDS       T01087                                 

Definition
Acyl-protein thioesterase, putative (EC:3.1.1.1)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RCOM_0924650
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RCOM_0924650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 255 aa AA seqDB search
MSNSTSAIGSGSGSSAKTFEFGRTHVVRPKGQHQATIVWLHGLGDKGSSWSQLLETLPLP
NIKWICPTAPTRPVSIFGGFPCTAWFDVADISEDAPDDLEGLDASAAHVANLLSTEPADI
KLGIGGFSMGAATALYSATCRVLGQYGNGNLYTISPSAIVGLSGWLPCSRSLRNRMEGSH
EAARSAASLPILLCHGLGDDVVAYKLGEKSAQTLSSAGFRNLTFKPYNGLGHYTIPAEMD
EVCNWLTTKLELEGS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagtacctccgctattggttcaggaagtggaagtagcgcgaagacgtttgag
tttggaaggacccatgtggtcaggccaaaaggacaacaccaggcaaccatagtttggctg
cacggccttggagataagggctccagctggtcccagctcctggaaacccttcctctgcca
aatattaaatggatttgcccaactgctccaacaaggccagtatcaatatttggtggattt
ccatgcactgcttggtttgatgtcgcggatatttcggaagatgctcctgatgacttagag
gggctggatgcttcagcagcacatgttgccaatctgttatcaacagagcctgctgatatc
aaacttggtattggtggcttcagcatgggtgctgccactgctctttattctgccacatgt
cgcgttttaggacaatatggaaatggaaatctctataccatcagcccaagtgcaattgtt
ggtctaagtggctggcttccatgttcaaggtctttgaggaatcggatggaagggtcgcat
gaagctgcacggtctgccgcatccttgcccattctgctctgtcacggtttaggtgatgat
gtggttgcatataagcttggagagaaatcagcacagacattaagttcagctggatttcga
aatcttacatttaaaccctacaatggcctcggccactatacaattcctgcagagatggat
gaagtctgtaattggctaaccacaaagttggagctagagggctcatga

DBGET integrated database retrieval system