KEGG   Ricinus communis (castor bean): RCOM_0924650Help
Entry
RCOM_0924650      CDS       T01087                                 

Definition
Acyl-protein thioesterase, putative (EC:3.1.1.1)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rcu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 255 aa AA seqDB search
MSNSTSAIGSGSGSSAKTFEFGRTHVVRPKGQHQATIVWLHGLGDKGSSWSQLLETLPLP
NIKWICPTAPTRPVSIFGGFPCTAWFDVADISEDAPDDLEGLDASAAHVANLLSTEPADI
KLGIGGFSMGAATALYSATCRVLGQYGNGNLYTISPSAIVGLSGWLPCSRSLRNRMEGSH
EAARSAASLPILLCHGLGDDVVAYKLGEKSAQTLSSAGFRNLTFKPYNGLGHYTIPAEMD
EVCNWLTTKLELEGS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagtacctccgctattggttcaggaagtggaagtagcgcgaagacgtttgag
tttggaaggacccatgtggtcaggccaaaaggacaacaccaggcaaccatagtttggctg
cacggccttggagataagggctccagctggtcccagctcctggaaacccttcctctgcca
aatattaaatggatttgcccaactgctccaacaaggccagtatcaatatttggtggattt
ccatgcactgcttggtttgatgtcgcggatatttcggaagatgctcctgatgacttagag
gggctggatgcttcagcagcacatgttgccaatctgttatcaacagagcctgctgatatc
aaacttggtattggtggcttcagcatgggtgctgccactgctctttattctgccacatgt
cgcgttttaggacaatatggaaatggaaatctctataccatcagcccaagtgcaattgtt
ggtctaagtggctggcttccatgttcaaggtctttgaggaatcggatggaagggtcgcat
gaagctgcacggtctgccgcatccttgcccattctgctctgtcacggtttaggtgatgat
gtggttgcatataagcttggagagaaatcagcacagacattaagttcagctggatttcga
aatcttacatttaaaccctacaatggcctcggccactatacaattcctgcagagatggat
gaagtctgtaattggctaaccacaaagttggagctagagggctcatga

DBGET integrated database retrieval system