KEGG   Ricinus communis (castor bean): RCOM_0934840Help
Entry
RCOM_0934840      CDS       T01087                                 

Definition
alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RCOM_0934840
  Lipid metabolism
   00561 Glycerolipid metabolism
    RCOM_0934840
   00600 Sphingolipid metabolism
    RCOM_0934840
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    RCOM_0934840
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RCOM_0934840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MKTRVRIGYVFVLVLVLLLCTSAISKNISSEEDHYSQFLLANGVGRTPPMGWNSWNHFQC
NIDEWTVKTTADALISTGLAALGYKYVNIDDCWAEENRDSKGNLRAKSSTFPSGIKALAD
YVHSRDLKLGIYSDAGYTTCSKKMPGSLVHEEQDARTFAQWGVDYLKYDNCYHDGSKPQI
RYARMSYALHKAGRPIFYSLCEWGQEDPAKWAGRYGNAWRTTGDIKDNWESVTSLADENN
IWGRYAGPGRWNDPDMLEVGNGGMSLEEYRSHFSIWALMKAPLLIGCDVRSASKQTLRIL
GNKEVIDVNQDPLGIQGRKIRSGAGLEIWAGPLSRKRIVILLWNRSGSKAPISVGWREVG
LSPITPVNIRDLWAHSFISMRKRFGLTAYVAPHACKMYILTPL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagagttagaatcgggtacgtttttgttcttgttcttgttcttcttttatgc
acaagcgccatttcaaagaatatcagcagtgaagaagatcattacagtcagttccttctt
gcaaatggcgtgggtcgtacaccaccaatgggctggaatagctggaatcacttccaatgt
aatatagatgagtggactgtcaagactactgcggatgcacttatttcaactgggttggct
gcacttggatacaaatatgtgaatattgatgactgttgggctgaagagaacagagactcg
aagggcaatctgagggcaaaatcttctacctttccttctggaatcaaggcccttgcagat
tatgttcattcaagagacttaaaactgggcatatattccgatgcaggttatacaacctgc
agcaagaaaatgccaggttcccttgtgcatgaagagcaggatgcaagaacctttgcccag
tggggggttgactacttgaagtatgataactgctaccatgatggttccaaacctcaaatc
agatatgccaggatgagctatgcattgcataaggcaggccggccgattttttactcttta
tgtgaatggggacaagaggatccagcaaaatgggctggccggtatggtaacgcttggaga
actacaggggacatcaaagacaattgggagagtgtcacatcactcgcagatgaaaacaac
atttggggaagatatgccggacctggcaggtggaatgatcctgacatgttagaagtgggc
aatggaggaatgagtctagaggagtaccgctctcattttagtatttgggctttaatgaaa
gctcctctactcattgggtgtgatgtccgatccgcaagtaaacaaactcttagaatcctt
ggaaacaaggaggtaatagacgttaatcaagatccacttggaattcaaggcaggaaaata
cgatcgggagccggtctagagatttgggcagggccattgtcgaggaaaagaattgttata
ttgttatggaataggagtgggtccaaggctcctatatcagtaggatggagggaagttgga
ctttccccaattactcctgttaatatcagagacttgtgggcacattcatttatttcgatg
agaaagcgttttggcctaactgcatatgttgctcctcatgcttgcaagatgtatatcctg
accccattgtag

DBGET integrated database retrieval system