KEGG   Ricinus communis (castor bean): RCOM_0936010Help
Entry
RCOM_0936010      CDS       T01087                                 

Definition
tfiih, polypeptide, putative
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
rcu  Ricinus communis (castor bean)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    RCOM_0936010
  Replication and repair
   03420 Nucleotide excision repair
    RCOM_0936010
Transcription machinery [BR:rcu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     RCOM_0936010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 451 aa AA seqDB search
MPQVRIIAKNFMDMVASLPAMKLDKLYTNPFICQAILRSLPPLAKKYVVQILYIDGPVAD
KTLEEWLLPDGSSKHRVAIDRLTQLRIFTEIVDRKKEISYKLNPTFQTNLQKHLIDGGVL
PGEPLASNIAVRLPTLEELDTYALGQWECFLLHLINSGHAERSTNFSSSMMKIFQRGLLT
QRDKEAPRLTESGFQFLLMDTNAQLWYIIREYISNSEERGLDSADLISFLLELSFHITGE
AYNMIMLTEFQRNMIKDLADLGLVKLQQGRKESWFIPTKLATNLSMSLTDSSSRKQGFVV
VETNFRMYAYSTSKLHCEIMRLFSRVEYQLPNLVVGAMTKESLYSAFENGITAEQIISFL
QQNAHPRVAERIPSVPENVTDQIRLWESDMNRVEMTPAHLYDEFPSRDVFEAACNFARDW
NGLLWEDSKRMRMVVKAEIHLNMREYLRGQK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaagtgaggatcattgctaagaatttcatggacatggtggcgtctttgcctgcc
atgaagctcgataagctttacaccaatcccttcatttgccaagccattctcaggtcattg
ccgcctttagcgaagaaatatgtggtacaaatattgtatattgatggtccagtagcagac
aaaacgctagaagaatggctacttcctgatggatcatctaagcacagagtagctattgat
cgattgacccagttgagaattttcactgagattgttgacaggaaaaaggaaatcagttac
aaattaaatcctacatttcagactaatctccagaagcatttaatagatgggggagttttg
cctggggaaccattggcttcaaatatcgctgtaagactcccaacattggaggaacttgat
acatatgcacttggacagtgggagtgtttcttgctgcatcttataaattcgggacatgca
gaaaggtcaactaactttagctcttctatgatgaaaatattccagcggggtcttttgact
caaagggacaaagaagctccacgattaactgagagtggtttccagtttctgctgatggat
acaaatgcacaactttggtatatcatcagagaatatatttctaactctgaggagcgtggt
ctggattcagcagatctgatttcctttttgctagagcttagttttcatatcactggtgag
gcatataatatgattatgttgactgaatttcagaggaatatgataaaggaccttgcagac
ttgggattggtgaaacttcagcagggcaggaaggagagttggtttatacctactaaatta
gctaccaatctctctatgagcttgacagattcatcatcacggaaacagggatttgttgtc
gtggaaacaaattttaggatgtatgcatactcaacgtctaagctgcattgcgaaattatg
cgtcttttctcaagggtagagtaccaacttccaaatcttgttgtcggggcaatgacgaaa
gaaagcttgtacagtgcttttgaaaatggcatcacagcagagcagataatttcttttctt
cagcagaatgcccatcctcgtgttgctgagagaataccttctgttcctgagaacgtcaca
gatcagataagactctgggagtcggacatgaacagggttgagatgacccctgcacatctc
tatgatgaattcccctctagggatgtctttgaggccgcttgtaactttgcacgagactgg
aatggtttactgtgggaagattcgaaaaggatgcgcatggtagtgaaggcagagattcac
ctgaacatgcgagagtatcttcgtggacagaagtaa

DBGET integrated database retrieval system