KEGG   Ricinus communis (castor bean): RCOM_0955780Help
Entry
RCOM_0955780      CDS       T01087                                 

Definition
Ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     RCOM_0955780
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   RCOM_0955780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 889 aa AA seqDB search
MENNDVSEDLSDLTHRQPDSDNNDQRLYFVPYRWWKDAQDSTISSESDGKRGVLYMGTSG
SSYAGPMKLINNIFNSDLVLNLRREEESLQNGENGEVGVSGRDYALVSGEMWLKALKWHS
DAKVASKSSKTFSAAEDDMSDVYPLQLRLSVLREVNSLGVKISKKENATELFRRACKIFS
VDSEMLRIWDFSGQTTLFFVNDKSKSPKESQRQLDQEIVLELQVYGLSDNMKCRDGKKDD
AVAQNCNGTHSSGTSLMNGSVSNTSTSFFRCDSSALFGKSGEAGSLGLTGLQNLGNTCFM
NSAIQCLAHTPKLVDYFLGDYGREINHDNPLGMDGEIALAFGDLLRKLWAPGATPVAPRT
FKSKLARFAPQFSGFNQHDSQELLAFLLDGLHEDLNRVKSKPYVEAKDGEGRLDEEVADE
YWQNHVARNDSIIVDICQGQYKSTLVCPICKKVSVTFDPFMYLSLPLPSTNIRTMTLTVV
STDGSSQPSSFTISVPKYGKCEDLTQALSKACSLGIDEMLLVAEVYNNRIIRYLEEPSDS
LSLIRDGDRLVAYRLKKELDNIPLVVFMHQHMEEQYVHGKQTSSWKAFGIPLVGPVHSLV
NGSDIHNLYLKLLSPFHIPADDGMYSCNNTTSTAKEEITEKDNGCSASHGNANPSIVEEA
TNSSSYSELQFYITDEKGIVQDLKIGINEPVPVTGVPKRFNVLVCWTEKQIEQYDTRLLS
SLPEVFKSGFLAKRPQESVSLYKCLEAFLKEEPLGPDDMWFCPSCKKHRQASKKLDLWRL
PEILVIHLKRFSYTRFMKNKLEAYVDFPVDDLDLSAYISYKNGQLSHRYMLYAISNHYGS
MGGGHYTAFVHHGAGRWYDFDDSLVHPISQDKIKTSAAYVLFYRRVVEV
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggagaataatgatgtatccgaagatctctctgatttaactcatcggcaacctgactcc
gacaacaatgaccagcgactctattttgttccttacaggtggtggaaggatgcgcaagat
tcaacaatatcgagtgaatctgatgggaagagaggggtcctctatatggggacttcaggt
tcttcttatgcaggtcctatgaagcttatcaacaacatttttaactcggatcttgtattg
aatttgaggagagaagaggaatctttgcagaatggtgagaatggtgaagttggtgtttct
gggcgagactatgcattggtctccggagaaatgtggttgaaggcactcaaatggcatagt
gatgctaaagttgcatccaagtctagcaaaacattttctgctgcagaagatgatatgtca
gatgtctatcccctgcaattgaggctttctgtgttgcgggaagtgaattccttaggtgtt
aaaattagcaagaaggaaaatgcaactgagcttttcagaagagcctgcaagattttcagt
gttgattctgagatgctacgcatatgggacttttcagggcaaacaacccttttttttgta
aatgacaaaagtaaatcaccaaaagaatctcagcggcaattagatcaggagatcgttttg
gagttacaagtttatggattgtcggataacatgaaatgcagagatgggaaaaaggatgat
gctgttgcacaaaattgtaatggaacacattcttctggaacttcacttatgaatggtagt
gtcagcaatactagcaccagttttttccgttgtgattcttcagccttgtttggaaaatct
ggagaagctggctctttgggattgacaggactacagaatcttggaaatacttgctttatg
aacagtgccattcagtgcctagcacacacaccaaagcttgttgattattttcttggagat
tatggcagggaaataaatcatgacaacccattgggcatggatggtgagattgcattagct
tttggggatctattgaggaaattatgggctcctggagcaactccagtggcacctagaacg
ttcaagtcaaagcttgctcgatttgctcctcaattcagcggatttaatcaacatgattct
caggaactccttgccttcttgttggatggacttcatgaggatctcaatcgtgtaaaatca
aagccttatgtagaagccaaggatggagagggtagattggacgaagaagttgctgatgaa
tattggcagaatcatgtggctcgcaatgactcaattattgttgatatctgccaaggtcaa
tataaatcaacattagtctgtcctatttgcaagaaggtgtcagttacatttgatccattc
atgtacttgtctctacctctaccttcaacaaatatacggactatgactttgacagttgtg
agtactgatggaagtagccagccatcttcatttaccatttctgtacccaagtatggaaaa
tgtgaagatcttacccaggctttaagcaaagcatgttctttggggattgatgagatgctc
ttggtggcagaggtatacaataaccgcattatacgatatctagaggagccatctgattct
ttatcattaattagagatggtgatcgtctggttgcttatcgattaaagaaagaattagac
aatattcctttagttgtatttatgcatcagcatatggaggagcagtatgtccatggaaaa
caaacttcaagttggaaggcatttgggattcctcttgtaggaccggtccacagtcttgtc
aatggatctgacatccataatttgtatctaaagctgcttagtccatttcatatacctgct
gatgatggcatgtatagttgtaataacactactagtactgcaaaggaagaaattacagaa
aaggataatggttgttctgcttcgcacggaaatgcaaacccctctattgtagaagaggcc
actaactcatcttcatattctgaactacagttttatataacagatgagaagggaatagtt
caggacttgaagataggtataaatgagcctgtaccagttacaggagtgccaaaacggttt
aatgttcttgtatgttggacagaaaaacaaattgaacaatatgatactcgcttgcttagc
tcattacctgaggttttcaagtctggctttcttgcaaagagacctcaggaatctgtttct
ctgtacaagtgtcttgaagcatttttaaaggaagaacctcttggaccagatgacatgtgg
ttctgtccaagctgcaaaaagcaccgtcaagccagtaaaaaattagatctttggagactg
ccagagattctggttattcatttaaagaggttctcttatacccgttttatgaagaacaag
cttgaggcttatgttgacttccctgttgatgatcttgatttgtcagcttacatttcctac
aagaatggtcaattatctcatcgctatatgctttatgctatcagtaatcactatggaagc
atgggaggtggtcattacacagcatttgtccatcatggggctggcaggtggtatgacttt
gatgatagcctagttcatccaatcagccaggacaagataaagacttcggctgcttatgtg
cttttctacagaagagttgtagaagtttaa

DBGET integrated database retrieval system