KEGG   Ricinus communis (castor bean): RCOM_0962250Help
Entry
RCOM_0962250      CDS       T01087                                 

Definition
choline/ethanolamine kinase, putative (EC:2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RCOM_0962250
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     RCOM_0962250
    2.7.1.82  ethanolamine kinase
     RCOM_0962250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MAIKTNELVEGISQEELKKILQSVASEWGDVVDDMEALQVMPLKGAMTNEVFQINWPTRS
GDVIRKLLIRIYGKGVEVFFKRDDEIRTFECMSKHGQGPRLLGRFADGRVEEFIHARTLS
AADLRDPEISALVAAKMREFHDLDMPGPRNVLLWSRMRNWLTKAKHLCSAKDAKKFHLDC
LGDEINMLEKQLSQEVQDIGFCHNDLQYGNIMMDEETRSITIIDYEYASYNPIAYDIANH
FCEMAANYHSETPHVLDYSKYPGLEERRRFVHVYLNSGGKKPSEDKVERLTDDAEKYTLA
NHLFWGLWGIISGYVNKLDFDYMEYARQRFEQYWVRKAEVLGSSGVHANGYVVDAT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctataaagacaaatgagttggttgaagggatttcccaagaagagctaaagaaaatt
cttcaatcagtggcatctgagtggggagatgtggttgatgatatggaagctttgcaggtt
atgccattgaagggagctatgactaatgaggtttttcagataaattggcctacaaggagt
ggtgatgttattaggaaattgctgattcggatttatggtaaaggtgttgaagttttcttt
aaaagggatgatgagattaggacttttgagtgtatgtcaaagcatggacaagggcccaga
cttcttggccgatttgctgatggcagggttgaagagttcattcatgccaggacactgtcg
gctgctgacctccgtgatcctgaaatttctgctctagtagcagcaaagatgagagaattc
catgatttagatatgcctggccctaggaatgtactcctgtggagcagaatgaggaattgg
ctgaccaaggccaagcatttgtgttctgcaaaagatgcaaagaaatttcacttggactgt
ctaggagatgaaatcaatatgctagagaagcagctttcacaagaagttcaggatattggg
ttttgtcacaatgacctgcaatatggtaatatcatgatggatgaagagacgagatcaatc
accataattgattatgagtatgcgagttacaatcctattgcatatgacattgcaaatcac
ttttgtgaaatggcagcaaattatcattctgagacaccacatgttttggactatagcaaa
tatcctggattggaagagcgccgcagatttgttcatgtatatctaaattctggaggcaaa
aaacccagtgaagacaaagtggaacggctgactgatgatgcagagaagtacactcttgca
aaccatctcttttggggcttatggggaataatctcaggttatgtcaataaacttgatttt
gattacatggagtatgctaggcagaggtttgagcagtattgggtgagaaaggctgaagtc
ttgggatcctctggtgttcatgcaaatggctatgtagtagatgctacctaa

DBGET integrated database retrieval system