KEGG   Ricinus communis (castor bean): RCOM_0991560Help
Entry
RCOM_0991560      CDS       T01087                                 

Definition
(RefSeq) histone acetyltransferase gcn5, putative (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     RCOM_0991560
Transcription machinery [BR:rcu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     RCOM_0991560
Chromosome [BR:rcu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    RCOM_0991560
   HAT complexes
    PCAF complex
     RCOM_0991560
    STAGA complex
     RCOM_0991560
    TFTC complex
     RCOM_0991560
    SAGA complex
     RCOM_0991560
    SLIK complex
     RCOM_0991560
    ADA-HAT complex
     RCOM_0991560
    HAT-A2 complex
     RCOM_0991560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MDTHSHSHLNVTNRSRSSQSPSPSHSASASATSSIHKRKLAAAASAASEDHAPPFPPSSF
SADTRDGALTSNDDLESISARGADSDSDADDSDAVVDDDEDEFDNDSSMRTFNAARLETN
AGASAPGGGSGGGGSSARNTKIKTENSTVKIEKLDGGKDGGTGAMGSITAGSSILAKEDA
VKIFTENLQTSGAYSAREESLKREEEAGRLKFVCLSNDGIDAHMVWLIGLKNIFARQLPN
MPKEYIVRLVMDRSHKSVMVIRRNHVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTR
LMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILME
CKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYQGIDFQKKEAGIPKKIVKVEDIP
GLREAGWTPDQWGHSRFNTFNTSTDTATNQKHWTAFMRSLLKSMHDHVDAWPFKEPVDGR
DVPDYYDIIKDPIDLKTMSKRIESEQYYVTFDMFVADVKRMFANARTYNSPDTIYYKCAT
RLEAHFESKVQSGFQSAKIQQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggacactcactctcactctcacctaaacgtaactaaccgctctcgtagctctcagtct
ccatctccgtctcactcagcttccgcctccgccacttcctcaattcacaaacgcaagcta
gcagccgccgcctcagccgcatctgaagaccatgctccaccatttcctccttcatctttc
tccgccgacacacgcgacggcgcactcacttccaacgacgatctagagagcatttcagct
cgcggcgctgattccgactccgacgccgacgattcagacgccgtcgttgatgatgacgag
gatgagtttgacaacgactcctccatgcgcacgttcaatgccgcgcgtctcgagaccaat
gccggagcctccgctcccggcggtggttccggtggtggcgggtcgtcggctcggaataca
aagataaagacggagaattcgacggttaagattgaaaagttagatggcgggaaagatggt
gggaccggtgcaatggggtccatcacggctggtagctcgatattggcgaaggaagacgct
gttaagatatttactgagaatttgcaaaccagtggcgcatatagtgctagagaagaaagt
ttaaagagagaggaagaagcaggaagactcaagtttgtatgtctttcaaatgatggtatt
gatgcccacatggtctggttgataggattgaagaacatatttgccaggcaattgcctaac
atgcctaaggagtacattgtccgtcttgtcatggatcgaagccacaaatccgtcatggtc
atcagacgtaatcacgttgttggtggcatcacatatcgtccatatgtcagccaaaagttt
ggggagatagctttttgtgcaatcacagcagatgaacaagtaaaagggtatggaacaaga
ttgatgaatcatttgaagcagcacgcacgcgacgttgatgggctgacacattttctgaca
tatgccgacaataatgctgttggttatttcattaaacagggttttaccaaagagatttac
ttggagaaggatcgatggcaagggtacattaaagactatgatggaggtatccttatggag
tgcaaaattgatccaaaacttccatacactgatttgtcaacaatgattcgtcgtcaaaga
caggcaattgatgaaaagataagagagctatccaattgtcacattgtttatcaagggatt
gactttcagaagaaagaagctggcattcctaaaaagattgtcaaggttgaagatattcct
ggcttgagggaggctggatggactcctgatcagtggggccattcgcgttttaatacattt
aatacttctacagacactgccacaaatcagaagcattggactgcattcatgcgctcactt
ttaaagtcaatgcatgaccatgttgatgcttggccatttaaggagccagttgatggtcgt
gatgtccctgattattatgacattatcaaagaccccatagacctgaagacaatgtcaaaa
aggatagagtcagagcaatactacgtaacatttgacatgtttgtggcggatgttaagagg
atgtttgccaatgcacgcacatataactcacctgatacaatctactataaatgtgcaacc
aggttggaagcccattttgaaagcaaagttcaatcaggtttccagtctgctaaaattcag
cagtaa

DBGET integrated database retrieval system