KEGG   Ricinus communis (castor bean): RCOM_0991560Help
Entry
RCOM_0991560      CDS       T01087                                 

Definition
histone acetyltransferase gcn5, putative (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MDTHSHSHLNVTNRSRSSQSPSPSHSASASATSSIHKRKLAAAASAASEDHAPPFPPSSF
SADTRDGALTSNDDLESISARGADSDSDADDSDAVVDDDEDEFDNDSSMRTFNAARLETN
AGASAPGGGSGGGGSSARNTKIKTENSTVKIEKLDGGKDGGTGAMGSITAGSSILAKEDA
VKIFTENLQTSGAYSAREESLKREEEAGRLKFVCLSNDGIDAHMVWLIGLKNIFARQLPN
MPKEYIVRLVMDRSHKSVMVIRRNHVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTR
LMNHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILME
CKIDPKLPYTDLSTMIRRQRQAIDEKIRELSNCHIVYQGIDFQKKEAGIPKKIVKVEDIP
GLREAGWTPDQWGHSRFNTFNTSTDTATNQKHWTAFMRSLLKSMHDHVDAWPFKEPVDGR
DVPDYYDIIKDPIDLKTMSKRIESEQYYVTFDMFVADVKRMFANARTYNSPDTIYYKCAT
RLEAHFESKVQSGFQSAKIQQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggacactcactctcactctcacctaaacgtaactaaccgctctcgtagctctcagtct
ccatctccgtctcactcagcttccgcctccgccacttcctcaattcacaaacgcaagcta
gcagccgccgcctcagccgcatctgaagaccatgctccaccatttcctccttcatctttc
tccgccgacacacgcgacggcgcactcacttccaacgacgatctagagagcatttcagct
cgcggcgctgattccgactccgacgccgacgattcagacgccgtcgttgatgatgacgag
gatgagtttgacaacgactcctccatgcgcacgttcaatgccgcgcgtctcgagaccaat
gccggagcctccgctcccggcggtggttccggtggtggcgggtcgtcggctcggaataca
aagataaagacggagaattcgacggttaagattgaaaagttagatggcgggaaagatggt
gggaccggtgcaatggggtccatcacggctggtagctcgatattggcgaaggaagacgct
gttaagatatttactgagaatttgcaaaccagtggcgcatatagtgctagagaagaaagt
ttaaagagagaggaagaagcaggaagactcaagtttgtatgtctttcaaatgatggtatt
gatgcccacatggtctggttgataggattgaagaacatatttgccaggcaattgcctaac
atgcctaaggagtacattgtccgtcttgtcatggatcgaagccacaaatccgtcatggtc
atcagacgtaatcacgttgttggtggcatcacatatcgtccatatgtcagccaaaagttt
ggggagatagctttttgtgcaatcacagcagatgaacaagtaaaagggtatggaacaaga
ttgatgaatcatttgaagcagcacgcacgcgacgttgatgggctgacacattttctgaca
tatgccgacaataatgctgttggttatttcattaaacagggttttaccaaagagatttac
ttggagaaggatcgatggcaagggtacattaaagactatgatggaggtatccttatggag
tgcaaaattgatccaaaacttccatacactgatttgtcaacaatgattcgtcgtcaaaga
caggcaattgatgaaaagataagagagctatccaattgtcacattgtttatcaagggatt
gactttcagaagaaagaagctggcattcctaaaaagattgtcaaggttgaagatattcct
ggcttgagggaggctggatggactcctgatcagtggggccattcgcgttttaatacattt
aatacttctacagacactgccacaaatcagaagcattggactgcattcatgcgctcactt
ttaaagtcaatgcatgaccatgttgatgcttggccatttaaggagccagttgatggtcgt
gatgtccctgattattatgacattatcaaagaccccatagacctgaagacaatgtcaaaa
aggatagagtcagagcaatactacgtaacatttgacatgtttgtggcggatgttaagagg
atgtttgccaatgcacgcacatataactcacctgatacaatctactataaatgtgcaacc
aggttggaagcccattttgaaagcaaagttcaatcaggtttccagtctgctaaaattcag
cagtaa

DBGET integrated database retrieval system