KEGG   Ricinus communis (castor bean): RCOM_0991580Help
Entry
RCOM_0991580      CDS       T01087                                 

Definition
trytophan synthase alpha subunit, putative (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCOM_0991580
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCOM_0991580
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCOM_0991580
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCOM_0991580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MAVALKSTTSFLHDRKPETHLLIRSPSYKPTVISTRRFAPMATLTAAKNLSLSETFSNLK
KRGKVAFIPYITAGDPDLSTTAEALKLLDSCGSDIIELGVPYSDPLADGPVIQAAATRSL
ARGTNFDAITSMLKEVVPQLSCPIALFTYYNPILKRGIEKFMSTVKDIGVHGLVVPDVPL
EETELLRNEAAKKNIELVLLTTPTTPTERMKAIVEAAEGFVYLVSSVGVTGARASVSDRV
QTLLQEIKEATAKPVAVGFGISKPEHVKQVAGWGADGVIVGSAMVKVLGEAKSPEEGLEE
LATLTKSLKSALV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgccttaaaatcaacgactagcttcctccacgacaggaaaccagagacccat
cttttaattcgttctccctcttacaaacccaccgtcatttcaaccagaagatttgctcca
atggccactctcactgcagctaagaatcttagtctgtctgaaactttctctaatctgaaa
aagcgaggcaaagtggcattcattccatacataacagctggtgaccctgacctttcaacc
acagcagaagccttgaagctgctggactcctgcggatctgacattattgaacttggtgtt
ccttactctgatcctttggcagatggtccagtgattcaggcggcagctacccgttctttg
gcaagagggaccaacttcgatgcaatcacatcaatgttgaaggaggtggttccacaatta
tcctgtcctattgctttatttacatattacaacccaatattaaagcgtgggattgagaag
tttatgtccactgttaaagacattggagtacatggacttgtagtccctgatgtacctcta
gaagaaactgaacttttgaggaatgaagctgctaagaagaatattgagctggtacttctg
acgacaccaactactccaacagaaagaatgaaagccattgttgaagcagcagagggattt
gtgtatcttgttagctcagttggagttacaggtgcccgtgcatctgtaagtgaccgagtt
caaacccttcttcaggagattaaagaggcgacagctaagcctgtagcagttggctttggg
atatcaaaacctgagcatgtgaaacaggtggcgggatggggcgccgatggtgtcattgta
ggtagtgctatggtgaaagtgttgggtgaagcaaaatctcccgaggaagggttagaggaa
ttagcaactctaaccaaatctttgaagtcagcacttgtttga

DBGET integrated database retrieval system