KEGG   Ricinus communis (castor bean): RCOM_0999770Help
Entry
RCOM_0999770      CDS       T01087                                 

Definition
amsh, putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    RCOM_0999770
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     RCOM_0999770
Peptidases [BR:rcu01002]
 Metallo Peptidases
  Family M67
   RCOM_0999770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 456 aa AA seqDB search
MKINVNEIARKVEVDNRIPLRYYYRIADNLLRQANIHREEKNIVDLYIILLRFSSLVSET
IPFHKDYHVSLPKERVAYIKSLLGVLNELESLKPVFHRRVEEINNAFARTQLCELDGPER
LSCDSEPSPSEYPLVNRTSYTNTNVKRPYGVALQSSWKYDNNNTQVSSSNSLPIDKQLNK
LSISLPLPKQETLSKHSILGPNGLRGQWRGPTAQIKVQYPNYADLTSSEDSSLNQAGLYD
IALNDNNSGGVGSTMESVLSLDDGIWPRPAEESIPALIHEAREDPFQFVGIRQPSPPPVL
AQVQQEFSPIPPSKVADPRPGPAKPSQDGIHNSNSYQHLHVPVNMMEDFLRLARANTKKN
LETCGVLAGSLKNRVFQITTLIIPKQESTSDSCQTINEEEIFEVQDRLALFPLGWIHTHP
SQTCFMSSVDLHTHYSYQIMLPEAIAIVMAPTDTSR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaatgtgaatgaaattgctcgaaaagtggaagtcgataatcggattcctctc
cgatactattacagaatcgctgataatctccttagacaggcgaatatacacagagaggag
aagaatatagtagatttgtatataatacttcttaggttttcgagtttggtgtctgaaact
attccatttcacaaggattaccatgtttcgcttccaaaagaaagagtagcttatataaag
agtttgttaggtgtattaaatgagcttgaatctttgaaaccggtatttcatcgtcgcgtt
gaagagattaacaatgcttttgcaagaacacaactttgtgaacttgatggcccagaacgg
ctttcatgtgattctgagccatctccttcagaatatcctcttgttaatagaacttcctac
actaacaccaatgtcaaacggccctatggtgtggcactacagtcttcatggaagtatgat
aacaataatactcaagtgtcatcttcaaactctctgccaattgacaagcagttgaataaa
ttatctattagtcttcctcttccaaagcaagagacattgtctaaacactcaattttaggc
cctaatggtcttcgaggccaatggcgaggacctactgcacagataaaggttcagtatcca
aattatgctgatttaacctcttctgaagattcaagtctgaatcaggctggactatatgat
attgcactgaatgataataattctgggggagttggctcaacaatggaatccgtgctctcc
ttagatgatgggatatggccacgtcctgctgaagagtcaatccctgcattaattcatgaa
gcaagggaagatcctttccagtttgttggcatcaggcaaccctccccacctcctgttctt
gctcaagtgcagcaagagttttctccaattcctccatctaaagttgcagatccaagacct
ggaccagcaaaaccttctcaggatgggattcacaactctaattcgtatcaacatttacac
gttccggtaaatatgatggaagacttcttgagattagctcgtgctaacacaaagaaaaat
ctagaaacatgtggtgttcttgctggttcattgaaaaacagggtctttcaaatcactaca
cttataatcccaaagcaagagtcaacttcagattcgtgtcagacaataaatgaagaagaa
atatttgaagttcaagacaggctggcactctttcctcttggatggattcatacacaccca
tcacagacatgtttcatgtcttctgttgatctgcacactcattactcgtaccagatcatg
ttacctgaagcaattgcaattgtcatggctccgactgatacatcaaggtag

DBGET integrated database retrieval system