KEGG   Ricinus communis (castor bean): RCOM_1003500Help
Entry
RCOM_1003500      CDS       T01087                                 

Definition
pyruvate dehydrogenase, putative (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     RCOM_1003500
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   RCOM_1003500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 351 aa AA seqDB search
MAAKKAFESLSKSFIQEVQRWGCMKQTGVSLRYMMEFGSRPTSKNLLISAQFLHKELPIR
IARRVIDLQSLPYGLSDKPAVLKVRDWYLDSFRDLRSFPDIKDSNDEKDFTQMIKAIKVR
HNNVVPMMALGVQQLKKGMDPKIVYEDLDEIHNFLDRFYMSRIGIRMLIGQHVELHNPNP
PPHCIGYIHTKMSPVEVARNATEDARAICLREYGSAPNVSIYGDPSFTFPYVPAHLHLMV
FELVKNSLRAVQERYMDSDKVAPPVRLIVAEGIEDVTIKVSDEGGGIPRSGLPKIFTYLY
STAKNPLDEHADLGTADTVTMAGYGYGLPISRLYARYFGGDLQVISMEGYG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaagaaggcctttgagtctttatctaagagctttatacaagaggttcagaga
tggggatgtatgaagcagactggggtcagtttgaggtacatgatggagtttggctccagg
cctacttctaagaatttgttgatttctgctcagtttcttcataaggaattgcctattcga
attgctcgccgagttattgatctccagtctctcccttatggtttatctgataaacccgct
gttttaaaggtgcgagattggtatctggattctttccgtgatcttagatcctttcctgat
atcaaggactcaaatgatgagaaggactttactcaaatgattaaggcaattaaggtcaga
cacaacaacgtggtccctatgatggccttaggtgttcaacagttgaagaaaggcatggat
cctaagattgtttatgaagatcttgatgagattcataactttttggataggttttacatg
tctagaattggaatcagaatgctcattgggcagcatgtggagttgcacaatcccaacccc
cctcctcattgcataggttatattcatacaaaaatgtctcctgtcgaggtagcccgaaat
gccactgaggacgcccgtgctatctgtctgcgggaatatggtagtgctcccaatgttagt
atttatggtgatcccagcttcactttcccgtatgttccagcacacttgcatcttatggtg
tttgagttggtcaagaattccttgcgtgctgtgcaagaacgctacatggactctgacaaa
gtagcccctcctgtacgattaatagtcgctgaaggaattgaggatgtcactatcaaggta
tcagatgaagggggtggtattccaagaagtggtcttcccaaaattttcacatacctttac
agtaccgcaaaaaacccactggatgagcatgctgatcttggaacagctgatacagtaaca
atggctggatatggatatgggctaccaattagccgcttgtatgctcggtattttggaggc
gatctgcaagttatttctatggaaggatatggttag

DBGET integrated database retrieval system