KEGG   Ricinus communis (castor bean): RCOM_1006980Help
Entry
RCOM_1006980      CDS       T01087                                 

Definition
serine/threonine protein phosphatase, putative (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rcu  Ricinus communis (castor bean)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:rcu03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 333 aa AA seqDB search
MQRAVLDGVIYRLLEVRGKPGKQVQLSENEIRQLCFTSREIFLKQPNLLELEAPIKICGD
IHGQYPDLLKLFEYGGLPPRANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGN
HECASVNRIYGFYDECKRRFNVRIWKFFTDCFNCLPVAALIDEKILCMHGGLSPDLRNLD
QIRSLQRPAVVPESGLLCDLLWSDPSKDIQGWGINERGVSYTFGADRVVEFLQKHDLDLI
CRAHQVVEDGYEFFANRQLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFQILKPVDKKPK
FSFGSMATAKPSTNSTKIKVRVSFVIYQIVLDF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgcagttcttgatggtgtgatttataggttgcttgaagttagaggcaagcca
gggaagcaggtccagctttctgagaacgaaattaggcagctctgtttcacttccagggag
attttcttgaaacagccaaatctcttggagcttgaagctcctatcaaaatctgtggagat
atacacggacaatatcctgatcttctgaagttattcgagtatggaggcttacctcctcga
gccaactatttattcttaggggattatgtagatcgaggaaagcaaagtctggaaactata
tgccttcttcttgcatataaaataaaatatcccgagaactttttcttactgagaggaaac
catgaatgtgcttctgtaaaccgtatatatggattttatgatgagtgcaaacgaagattc
aatgtcagaatatggaaattttttacagattgtttcaattgcttgcccgtggcagccctt
attgatgaaaagattctgtgcatgcatggtggactttctcctgatcttcgaaatttggat
cagattaggagtttacagcgacctgctgttgttcctgagtctggtttattatgtgatctt
ctatggtctgatcctagtaaagacattcaaggttggggcataaatgaaaggggtgtttca
tacacttttggtgctgatagggtcgttgaatttctgcagaagcatgatcttgatttaatt
tgtcgagcccatcaggttgtggaagatggatatgagtttttcgcaaacagacaacttgta
accatattttcagctccgaattattgtggagagtttgataatgctggcgccatgatgagt
gtggatgagaatttgctatgttccttccaaattctgaaacctgttgataagaagccaaag
tttagttttgggagcatggctactgctaagcctagcaccaattcaacaaaaatcaaggtg
cgcgtctcattcgtcatttaccaaatagtactagatttttaa

DBGET integrated database retrieval system