KEGG   Ricinus communis (castor bean): RCOM_1013490Help
Entry
RCOM_1013490      CDS       T01087                                 

Definition
Magnesium-chelatase subunit chlI, chloroplast precursor, putative (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rcu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 419 aa AA seqDB search
MASLLGTSSSTAFLSSRPFSSSSVTKPSFPSLSLTPGLTIGRKYCRGIGIQSKKGRSQFH
LTVTNVATDAQNVAAKESQRPVFPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK
STTVRSLVDLLPEISVVFGDPYNSDPEDPESMGVEVRESIMKGEELSVVLTKINMVDLPL
GATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASG
WNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVKDAELRVKIVEER
SRFDKNPKEFRDSYKAEQEKLQQQISSARTALSQVQIDRDLKVKISKVCAELNVDGLRGD
IVTNRAAKALAALKGRDKVSAEDIATVIPNCLRHRLRKDPLESVDSGLLVIEKFYEVFS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctttactgggaacttcttcttctactgcatttttatcatctaggcctttctcc
tcctcttccgtaaccaaaccttcctttccttctctctccttaactccagggctgactatt
ggaaggaagtattgtagaggaattggaattcagagcaagaagggaaggtctcagttccat
cttactgttaccaatgttgcaactgatgctcagaatgttgctgctaaagaaagccagagg
ccagtttttccatttgctgctatagtaggacaggatgagatgaaattgtgccttttgtta
aatgtgattgatcccaagattggaggggtcatgattatgggtgatagagggacagggaag
tctactactgttaggtccctggtggatttacttccagaaattagcgtagttttcggtgac
ccgtataactcagatccagaggatccagaatccatgggtgttgaagttagagaaagcatc
atgaaaggggaggagctttcggttgtgctgaccaaaattaatatggttgatttgccatta
ggagctactgaggatagggtctgcggaacaattgatattgaaaaggctctcactgagggt
gtcaaggcatttgagcctggccttcttgctaaagctaacagagggattctttatgtggat
gaagttaaccttttggatgaccacttagtggatgttcttttagattctgctgcctcagga
tggaacacagtggagagagagggtatttcaatttcacatcctgcacgctttattttgatt
ggctctggtaatcctgaagaaggggagctccggccccagctgcttgatagatttgggatg
catgcacaggtgggaactgtaaaggatgctgagctcagagtgaagatagtggaagaaaga
tctcggtttgacaaaaatcccaaggaattccgtgattcttacaaggcagagcaagagaag
ctgcaacaacaaatttcatcagctaggactgctctttctcaagtgcagatagatcgtgat
ctgaaggtaaagatttccaaggtttgtgcagagctgaacgttgatggattgagaggagac
attgtgactaacagagctgcaaaagctcttgctgctttaaagggtagagataaagtaagt
gcagaggatattgctactgtaattcccaactgtttaagacaccggctgcggaaggatcca
ttggaatctgttgactcgggtttgcttgtcattgagaaattttacgaagtttttagctga

DBGET integrated database retrieval system