KEGG   Ricinus communis (castor bean): RCOM_1019320Help
Entry
RCOM_1019320      CDS       T01087                                 

Definition
(RefSeq) hypothetical protein
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     RCOM_1019320
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   RCOM_1019320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1006 aa AA seqDB search
MGKRVKKKSRSLQKEKRVSTHSPKVAPQQTTPSVDVNERITVAVVKERKQCVHLGKGFNL
NNLTVKLGSSDPLKCEDCREGVADRRGAKGKGKHGKKKGSVDSKSESKAIWVCLECGHFA
CGGVGLPTTPQSHVVRHARQTRHPLIIQWENPHLRWCFPCNTLIPVEMTEENGEKKDALL
DVVNLIKTRSSQRSLVDVEDVWFGGGSVASEIKAEGTILSSTEGKSGYTVRGLVNLGNTC
FFNSVMQNLLAIDKLRDFFFNQDISFGPLTIALKKLFTETKQETGIKNVISPRSFFGSIC
SKAPQFRGYQQQDSHELLRYLLDGLSSEELAVRKQVNASKENGISSKHGPTFVDVLFGGR
ICSTVSCIECEYSSTVYEPFLDLSLPVPTKKPATKKAQPASRSKKTKLPLKRGGRVRAKA
NKDTDAVPAQSSSNPSVSSESPCQTLSIIPHAENSMASSGDVVGLESVCLTTVADKSGLA
SQNFSTIPDTENEQVTEGTVEQTTNSFDDFSWMDYLGQETVTDEHDLTLQNKDASTSQFS
ENIIPNDDIMESSQVSPVDGEPNLKLESSVNPWEEEVLAQVKSSEVLLLPYKEESVMDGD
VMKGQAEASSVVGCGQDEADFDGFGDLFNEPEVSSGPVSGPSLANGTAETGFIAANNSES
DPDEVDNSDSPVSIESCLAHFIKPELLSNDNAWECENCSKTLQRQRLEAKKKAKTTVETM
IIGGKAQIQSPSSLEKDNLCSIEVKDHNGGINTDTCFNSSGASLVSDDENIDRTNQNYIK
TESGQTDELNPIETQGDEQKGEMTVALMEQSLSSSTYKSCSQESFSCPVVGSSSVGEPSS
TGYATAKDQMGDSQFSGNCGAKEDEEGTSRKVKVKRDATKRVLVDKAPPILTIHLKRFSQ
DARGRLSKLNGHVNFGDVLDLRPYMDPRCTDREKYVYRLLGVVEHLGTMRGGHYVAYVRG
GQKSKGKAENESGSSVWYHASDAYVREVSLEEVLRCEAYILFYEKI
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaagggtgaagaaaaagagtcgttcactgcagaaggagaagagggtttcaaca
cattctcctaaagttgctcctcaacagaccactcctagtgttgatgttaatgagagaatt
acagttgcagtggtgaaagagagaaaacaatgtgtacaccttggcaaggggtttaatttg
aataatttaactgtgaaacttgggtcttcagatcctttaaagtgtgaggactgtcgtgaa
ggtgttgctgataggagaggggcaaagggaaagggtaaacatggaaaaaagaaaggatca
gttgattcaaaatctgaatcgaaagccatttgggtttgtttagaatgtgggcattttgct
tgtggtggagttggtttgccaacaacaccccagagccatgttgttcggcatgctagacaa
acccgccacccgttgataatccaatgggaaaatccacatctacgttggtgcttcccatgt
aatacattaatcccagttgagatgacagaggaaaatggtgaaaagaaagatgcactactg
gatgttgtaaatttgatcaagacacgatcatcgcagaggtcattggtggatgttgaggat
gtttggtttggaggtggtagcgttgcaagtgaaatcaaagcagaaggcacaatattgagc
agcacagagggaaaaagtggttacaccgtaagaggcctggttaatctggggaacacttgc
ttcttcaattcagtaatgcaaaatctattagccatagataagttgcgggatttcttcttc
aatcaagatatatcgtttggccctctaaccattgctttgaagaagctctttactgaaaca
aaacaagagactggtataaagaatgtgatcagtccaagatccttttttgggtctatctgt
tccaaggctcctcagtttaggggataccagcagcaagatagccacgaattgttgcgttat
ttgcttgatggtttgtcttccgaagagttggctgtgagaaaacaagtgaatgcttctaag
gaaaatgggatttcttcaaaacatggccctacctttgtggatgttctatttgggggccga
atttgtagtactgtttcttgtattgaatgtgagtactcttccactgtgtatgagccattt
ttggatctttcactaccagttccaaccaagaaacctgccacaaaaaaagcccaaccagct
tctagatcaaagaaaacaaagttgccactaaagagagggggaagggttcgagcaaaagct
aataaagatacagatgcagtgccagcacaaagcagttcaaacccctcagttagcagcgag
tctccatgtcaaaccctgtcaatcatacctcatgcagaaaactcaatggcttcttcaggt
gatgttgtaggattagagtctgtttgtttaactactgtagctgataaaagtggtttagcc
tcccaaaatttctcaactattccagacactgagaatgagcaagttactgagggtacagtg
gagcagacaacaaattcatttgatgacttctcatggatggattatcttggtcaagaaact
gttacggatgagcatgatttgactttgcaaaataaagatgcttcgacaagtcagttttct
gaaaatatcattccaaatgatgacataatggagagtagtcaagtgtctcctgttgatgga
gagccaaatctgaaactggaatcttcagtgaatccttgggaagaagaggtcctagcacag
gttaaaagctctgaagttctattgcttccatacaaagaggagagtgttatggatggtgat
gtaatgaaaggacaagctgaagcctcatctgttgtgggatgtggacaagacgaagcggat
tttgatggctttggtgatttattcaatgagcctgaagtttcttcaggacctgtttcaggg
ccctccttagccaatggtactgcagaaactggttttattgcagcaaacaacagtgaatct
gatccagatgaggttgataatagtgattctccggtgtcaattgagagttgtttggctcat
tttataaagccagaactactctctaatgataatgcctgggaatgcgagaattgttcaaaa
accctacaacgccaaagattagaagccaagaagaaagctaaaaccacagtagaaacaatg
ataattggcggtaaggctcaaatccaaagtccttcaagtttagagaaggacaacttatgt
tctatagaagtcaaagaccataatgggggtattaacacggatacttgtttcaactcctca
ggtgcaagcttggtttctgatgatgaaaacattgataggactaatcagaattacataaaa
actgaaagtggtcaaacagatgaactaaacccaattgaaactcaaggtgatgaacagaag
ggtgagatgactgttgctcttatggagcaatccctttcttcttctacttataaatcatgc
agtcaagaaagttttagttgtccagttgttggttcctctagtgttggcgagccaagtagc
accggatatgcaactgctaaagatcagatgggtgactcccagttctcaggaaattgtgga
gcaaaggaagatgaagaaggaacttctagaaaagtgaaagtgaagagggatgcaactaag
agagtcctagttgataaagccccacctattttgactattcatctaaagaggttcagccaa
gatgcccgtggtcgtttaagtaaattgaatggccatgtcaattttggagatgtacttgat
cttaggccttatatggatccaaggtgtacagacagggagaaatatgtatatcgtctgctt
ggggtagtggagcatttgggaacaatgagaggaggtcattacgttgcttatgtgagagga
ggtcagaagagtaaaggcaaggcagagaatgaaagtgggagttctgtttggtatcatgcc
agcgatgcctatgtgcgtgaggtttccttggaagaagttcttcgatgtgaggcctacatc
ttattttacgaaaaaatctga

DBGET integrated database retrieval system