KEGG   Ricinus communis (castor bean): RCOM_1020600Help
Entry
RCOM_1020600      CDS       T01087                                 

Definition
Chalcone synthase, putative (EC:2.3.1.74)
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    RCOM_1020600
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    RCOM_1020600
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     RCOM_1020600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MVSVQDVRRTQRAEGPATVLAIGTVTPTNSVDQSTYPDYYFRVTNSEHKTELKEKFKRMC
DKSMIKKRYMHLTEEMLKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQP
KSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSIKRLMMYQQGCFAGGTVLRLAKDLAEN
NKGARVLVVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPNVEKPLYELV
FTAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFW
IAHPGGPAILDQVEAKLGLEPNKLQATRHILSEFGNMSSACVLFIMDYMRKKSAEDGLES
TGEGLEWGVLFGFGPGLTVETVVLHSVANY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgtacaagatgttcgcaggactcaacgggctgaaggccctgcaacagtcttg
gctattggcactgtcacacctacaaactctgtcgatcagagtacatacccggattattac
ttccgtgtaacaaacagtgaacacaagaccgaacttaaagaaaagttcaagcgcatgtgt
gataaatcaatgataaagaagcgttatatgcacttgactgaggagatgttgaaagaaaat
ccaaatatttgtgcgtacatggctccttcattggacgcaagacaggatatagtagttgtc
gaagtacctaaactaggaaaagaggcagctgttaaggctattaaggaatggggccagccc
aaatcaaaaattacccacttggtcttttgtaccactagtggagtggatatgccaggggcc
gactatcagctcactaaactattgggcctacgcccatctatcaaaaggctcatgatgtac
caacagggttgtttcgccggaggcactgtgctccgcctagccaaagacctagccgaaaac
aacaaaggtgcccgtgtcctcgtcgtctgctcggagttaaccgccgtgacatttcgtggg
cctagtgacacgcacctcgatagccttgtgggccaagctttgtttggtgatggggcggct
gctgttatagtgggctcagacccagtgcctaacgtcgagaaacccttgtatgaactagtc
tttacggcccaaaccatacttccggacagtgatggggcgatcgacgggcatctccgtgaa
gtgggccttacgttccacctcctgaaggatgttcctggactgatctccaagaatattgag
aaaagccttgttgaggcattccagcccttgggcatttcagattggaactccatattttgg
attgcacatccaggtggacctgcaattcttgatcaagtagaagctaaacttgggcttgag
cccaataaattacaggccacaagacacatactttctgagtttggtaacatgtccagtgcc
tgtgtcttgttcatcatggactacatgagaaaaaagtcagccgaggatgggcttgagtct
actggagaaggcttagagtggggtgttctttttggttttgggcctgggctcactgtcgag
actgttgtactccacagtgtggctaattactag

DBGET integrated database retrieval system