KEGG   Ricinus communis (castor bean): RCOM_1023980Help
Entry
RCOM_1023980      CDS       T01087                                 

Definition
Beta-amylase, putative (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RCOM_1023980
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     RCOM_1023980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 574 aa AA seqDB search
MAMNITHQIGALAGTPISTEPIPSESTATVSAVWKTPTPNARCKIQKADTTEQKSQPTSP
CMSPILSGMRADLSVACRAFADVATLEPSIEERMYRDGGGKEEGKGVPVYVMMPLDSVTM
NNGVNRRKAMNASLQALKSAGVEGIMMDVWWGLVEREGPGVYNWGGYIELLEMAKRHGLK
VQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDRDVDLAYTDQWGRRNYEYLSLGCDTLPVL
KGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWRFPGIGA
FQCYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDTPFFKKDGGGWNSIYGEFF
LGWYSQMLLDHGERILSSATAIFENTGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFR
DGYLPIAQMLGRHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAQVPLAGENA
LPRYDDFAHEQILQASSLSINGDSDDREMCAFTYLRMNPHLFQEDNWRRFVAFVKKMKEG
KNVDRCREQVEREAEHFVHVSRPLVQEAAVALMH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaatataacacatcagataggagctctagctggaacaccaatctcaacagag
ccgataccaagcgaatcaacagcgacggttagcgcagtatggaaaacaccgacgccgaat
gcacgatgcaagattcaaaaggcagacactacagagcaaaaatcgcagccaacgagccca
tgcatgtcgccaatcctaagcggcatgcgtgcagatctctctgtcgcgtgtcgtgcgttt
gctgacgtggcaacattagaaccgtcgatagaagagagaatgtatagagatggtggaggg
aaagaggaaggcaagggagtcccggtgtatgtcatgatgccgttagacagtgtaacgatg
aataacggcgtcaatagacggaaagcgatgaacgcgagtttacaggcgttgaagagtgcc
ggagttgaggggataatgatggatgtgtggtggggattggtggagagagaaggtcctggt
gtttacaattggggtggatatatcgagcttttagaaatggctaaacgacacggtcttaag
gttcaagctgttatgtcgtttcatcagtgtggaggcaacgttggtgattcttgcactatt
ccattgcccaagtgggttgtggaggagattgacagagatgtagaccttgcatatacggat
cagtggggtagaaggaattatgaatatctatccttaggctgtgatacccttccagtactc
aaggggaggacacctgtgcagtgttactctgactttatgcgtgctttcagagacaacttc
aaacaccttcttggtgataccattgtggaaattcaagttgggatgggaccagcaggtgag
cttcgttatccttcttaccctgaacaaaatgggacatggagatttcctggcattggagct
ttccaatgttacgacaagtatatgctcagcagcctgaaagctgcagctgaagctgctggt
aagccagaatggggtagcacaggcccgactgatgctggtcattataacaactggccagaa
gatactccgtttttcaaaaaggatggtggtggttggaatagtatttatggtgaattcttc
ctcggttggtactctcagatgcttctagatcatggtgagagaatactgtcatcagccacg
gccatcttcgagaacacaggagtaaagatttcagtgaaggttgcagggattcattggcac
tatgggacaaggtctcatgcaccagagctcacagctgggtattataacacaagattccga
gatggttaccttccgattgcacaaatgttaggacgccatggtgcgatattcaacttcact
tgtattgagatgcgtgatcatgagcagccacaggatgccctttgtgcacctgagaagctt
gtcaggcaggtggctttagcaactcaggaagcacaggttccacttgctggcgaaaatgcc
ctgccacgatacgatgacttcgcacatgagcagatcttgcaggcatcatcgttgagtatt
aatggcgattcggatgatagagagatgtgtgcttttacgtacttgaggatgaatccccat
ttattccaggaagataactggagacgatttgtggcatttgtaaaaaagatgaaggaaggg
aagaatgttgatcggtgtagggagcaggtcgagcgggaagctgaacattttgtccatgta
agtcggcctttagtccaagaggctgcagtggctctaatgcattag

  All links  
No link information was found.   
DBGET integrated database retrieval system