KEGG   Ricinus communis (castor bean): RCOM_1030540Help
Entry
RCOM_1030540      CDS       T01087                                 

Definition
protein disulfide isomerase, putative (EC:2.4.1.119)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:rcu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MASFRGSIWYCIFVLSLIAVAISAAESEEEQSSVLTLDSTNFTDTISKHDFIVVEFYAPW
CGHCKKLAPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGK
SIQEYKGPREADGIAEYLKKQSGPASVEIKSTEAANTFIGDKKIFIVGVFPKFSGEEYEN
YMSVADKLRSDYEFGHTLDAKHLPQGESSVTGPVVRLFKPFDELFVDFKDFNVDALEKFV
EESSMPVVTVFNSDPSNHPFVIKFFNSPDAKAMLFMNFNGEAADSIKSKYQEVAHQFKGE
GIIFLLGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQKYLKANLEPDHIAPWVKAYKEGK
VQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVA
VSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIE
KNRDKAAQQESANGKDEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttaggggttcaatttggtattgtatctttgttttgtcgctaatagctgta
gcgatctcagctgctgagagtgaagaggaacagtcttccgtgttgacgttggattctact
aattttactgataccattagcaagcacgacttcatcgtcgtcgaattctatgctccatgg
tgtgggcactgtaagaagcttgctcctgagtatgagaaagctgcgtccatattgaaaagt
catgacattccagttgttttggccaaagttgatgctaatgaggaggctaacaaagagctt
gcaacccagtatgatattaagggattccctactcttaaaattttgagaaatggagggaag
tcaattcaagagtataaaggtcctcgagaagctgatggaattgctgagtatttgaagaaa
caaagtggtcctgcttctgttgaaataaaatcaacagaagctgctaatactttcattggt
gacaagaagatatttattgttggggtattccctaaattttctggggaggagtatgagaac
tatatgtctgtagctgataaattgcgttctgactatgaatttggtcatactttggatgct
aagcaccttccacaaggggaatcatctgtcactggtcctgttgttaggttgtttaagcca
tttgatgaactctttgttgatttcaaggattttaatgtggatgccctagagaagtttgtt
gaagaatctagtatgcctgttgtgactgtctttaacagtgaccccagcaatcaccctttt
gttatcaaatttttcaatagtcctgatgctaaggccatgttgtttatgaatttcaatggt
gaagctgccgattctatcaaatctaaatatcaagaagtcgcccaccaattcaaaggagaa
ggcataatctttttgttgggagatgtagaggctagtcaaggtgccttccagtattttgga
ctcaaagaggaccaagtgcctctcattatcattcaaactaatgacggacagaagtacttg
aaggcaaacttagagcctgatcacattgctccttgggtgaaggcttacaaggaaggaaaa
gtgcaagcatataggaaatctgaacctattccagaagttaacaatgagccagtgaaagtt
gtggttgctgatactctccaggacattgttttcaactctggcaaaaatgttcttctagag
ttttatgctccttggtgtgggcattgcaaacaattggctccaatcttggacgaagttgca
gtctcgtataaaagcgatgctgatattgtcattgctaagcttgatgctactgcaaacgat
atcccaagtgataccttcgatgtcaggggataccccactgtgtacttcagatcagcaagt
ggaaaggtggagcagtatgatggggataggacgaaagacgatatcatttctttcattgaa
aagaaccgagataaagctgcccagcaagaatcagctaatggaaaggatgagctctga

DBGET integrated database retrieval system