KEGG   Ricinus communis (castor bean): RCOM_1030540Help
Entry
RCOM_1030540      CDS       T01087                                 

Definition
protein disulfide isomerase, putative (EC:2.4.1.119)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    RCOM_1030540
Enzymes [BR:rcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RCOM_1030540
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RCOM_1030540
  Exosomal proteins of colorectal cancer cells
   RCOM_1030540
  Exosomal proteins of bladder cancer cells
   RCOM_1030540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MASFRGSIWYCIFVLSLIAVAISAAESEEEQSSVLTLDSTNFTDTISKHDFIVVEFYAPW
CGHCKKLAPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGK
SIQEYKGPREADGIAEYLKKQSGPASVEIKSTEAANTFIGDKKIFIVGVFPKFSGEEYEN
YMSVADKLRSDYEFGHTLDAKHLPQGESSVTGPVVRLFKPFDELFVDFKDFNVDALEKFV
EESSMPVVTVFNSDPSNHPFVIKFFNSPDAKAMLFMNFNGEAADSIKSKYQEVAHQFKGE
GIIFLLGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQKYLKANLEPDHIAPWVKAYKEGK
VQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVA
VSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIE
KNRDKAAQQESANGKDEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttaggggttcaatttggtattgtatctttgttttgtcgctaatagctgta
gcgatctcagctgctgagagtgaagaggaacagtcttccgtgttgacgttggattctact
aattttactgataccattagcaagcacgacttcatcgtcgtcgaattctatgctccatgg
tgtgggcactgtaagaagcttgctcctgagtatgagaaagctgcgtccatattgaaaagt
catgacattccagttgttttggccaaagttgatgctaatgaggaggctaacaaagagctt
gcaacccagtatgatattaagggattccctactcttaaaattttgagaaatggagggaag
tcaattcaagagtataaaggtcctcgagaagctgatggaattgctgagtatttgaagaaa
caaagtggtcctgcttctgttgaaataaaatcaacagaagctgctaatactttcattggt
gacaagaagatatttattgttggggtattccctaaattttctggggaggagtatgagaac
tatatgtctgtagctgataaattgcgttctgactatgaatttggtcatactttggatgct
aagcaccttccacaaggggaatcatctgtcactggtcctgttgttaggttgtttaagcca
tttgatgaactctttgttgatttcaaggattttaatgtggatgccctagagaagtttgtt
gaagaatctagtatgcctgttgtgactgtctttaacagtgaccccagcaatcaccctttt
gttatcaaatttttcaatagtcctgatgctaaggccatgttgtttatgaatttcaatggt
gaagctgccgattctatcaaatctaaatatcaagaagtcgcccaccaattcaaaggagaa
ggcataatctttttgttgggagatgtagaggctagtcaaggtgccttccagtattttgga
ctcaaagaggaccaagtgcctctcattatcattcaaactaatgacggacagaagtacttg
aaggcaaacttagagcctgatcacattgctccttgggtgaaggcttacaaggaaggaaaa
gtgcaagcatataggaaatctgaacctattccagaagttaacaatgagccagtgaaagtt
gtggttgctgatactctccaggacattgttttcaactctggcaaaaatgttcttctagag
ttttatgctccttggtgtgggcattgcaaacaattggctccaatcttggacgaagttgca
gtctcgtataaaagcgatgctgatattgtcattgctaagcttgatgctactgcaaacgat
atcccaagtgataccttcgatgtcaggggataccccactgtgtacttcagatcagcaagt
ggaaaggtggagcagtatgatggggataggacgaaagacgatatcatttctttcattgaa
aagaaccgagataaagctgcccagcaagaatcagctaatggaaaggatgagctctga

DBGET integrated database retrieval system