KEGG   Ricinus communis (castor bean): RCOM_1030560Help
Entry
RCOM_1030560      CDS       T01087                                 

Definition
porphobilinogen synthase, putative (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCOM_1030560
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RCOM_1030560
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCOM_1030560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 432 aa AA seqDB search
MASTIFNNAACTVPARKGLDCKNYVALKPTVHSLRFNCGTNSVKVCPKRVLMVRASERHD
GPIKKLGLTDAECEAAVVSGNVPEAPPVPPKPAAPAGTPVVPSLPLSRRPRRNRKSPAMR
ASFQETNISPSNFVYPLFIHEGEEDTPIGAMPGCYRLGWRHGLVEEVAKARDVGVNSVVL
FPKVPDALKSPTGDEAYNDNGLVPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVRED
GVIMNDETVHQLCKQAVSQARAGADVVSPSDMMDGRVGAIRAALDAEGFQHVSIMSYTAK
YASSFYGPFREALDSNPRFGDKKTYQMNPANYREALIEAHEDESEGADILLVKPGLPYLD
IIRLLRDKSPLPIAAYQVSGEYSMIKAGGVLKMIDEERVMMESLMCLRRAGADIILTYFA
LQAARCLCGEKR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcatccacaatcttcaataatgctgcttgtactgtccccgcaaggaagggcttagat
tgtaagaattatgttgctttaaaaccaactgttcatagtttgaggttcaattgtggtacg
aattcggttaaggtgtgtcccaagcgtgttctgatggtaagagcaagtgaaaggcacgat
gggccaattaagaagttgggacttactgatgcagaatgtgaagctgctgttgtgtctgga
aatgtgcctgaggcacctcctgtgcctcctaagcctgctgcaccagctggaacccctgtt
gttccttcacttccactcagtaggcgccctcgtcgtaatcgcaagtcacctgctatgaga
gcatcattccaagaaactaatatatcaccttctaattttgtctatccactttttattcat
gaaggtgaggaggacacaccgattggagcaatgcctggatgttacaggctcggatggaga
catggacttgtggaagaggtagcaaaagctcgggatgttggtgtcaatagtgttgttctc
tttcccaaagttccagatgctttgaagtctcctacaggagatgaagcatataatgataac
ggtctggtacctcggacaattcggcttctgaaggacaaataccctgatcttgttatttat
actgatgttgcccttgatccatattcctctgatgggcatgatggtattgtcagagaagat
ggagtcataatgaatgatgagacggtgcatcaattatgcaaacaagctgtttctcaggcc
cgagctggggcagatgttgttagtcccagtgacatgatggatggccgcgttggagcaatt
cgggcagctcttgatgctgaaggctttcagcatgtttcaatcatgtcctatacagccaag
tatgctagttcattttacggtccattccgagaagcactggactcaaatccacgctttgga
gacaaaaagacctatcagatgaacccggctaattacagagaggctctaattgaggctcat
gaagatgaatctgaaggagctgatatacttctggtcaaaccaggtcttccatatttggat
atcataaggcttctcagagataaatctcctttgccaattgctgcatatcaggtgtcaggt
gaatactccatgattaaggctggtggggttctcaaaatgattgatgaagaacgggttatg
atggagtccctaatgtgtcttcgacgggctggtgctgacatcatcctaacatattttgct
ctacaagctgctagatgtttatgtggtgagaagaggtga

DBGET integrated database retrieval system