KEGG   Ricinus communis (castor bean): RCOM_1032370Help
Entry
RCOM_1032370      CDS       T01087                                 

Definition
dual specificity protein kinase-ttk, putative (EC:2.7.12.2)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     RCOM_1032370
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: Other group
  TTK family
   RCOM_1032370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 832 aa AA seqDB search
MDREANLPKNNIARPILNSDSTSSSSSSFSSSSSPPEFLRHVQAAFKRHRALGTMQTNSL
MPRRILVPQRDTSQTSAASSDVYPKKFHDVINPSSQVQSRKDSSSTIMHTKNPVIAVVRE
TPEDASITPPPISATTITKTFGESFNVQRDQSKSAIECKENNPIPASFSHVESQHVDSKR
KVQFSIANNATSQEMEWDASNPVEALNVINEESKHRNFQNVDSDVCLRSDGAGSLLAKRT
MAVQDQLHQLRNFLSQPVTQSSVIGTSCATTTSVHSTSAPILNSTTYCSCSHPEGGTHAA
VEPAVEPLGDLNASSQHASQKNMEQLSNPSLRDTSGMLIDQTSIAAQPSTSVINAQIKEH
PVPRENEGRLAKGTDIPKNPSYVCEKPTKERVSADDVTDVQPQDPSSKNPPSDVKLESSK
PEKQEKVTGGKGASVPRKKNYDPDLFFKVNGKLYQRLGKIGSGGSSEVHKVISSDCTIYA
LKKIKLKGRDYATAYGFCQEILYLNKLKGKNNIIQLIDYEVTDKSLLREVMNESMSNKDG
RVKDDGYIYMVLEYGEIDLAHMLSQKWKEMDSAYQTIDENWLRFYWQQILQAVNTIHEER
IVHSDLKPANFLLVKGSLKLIDFGIAKAIMSDTTNIQRDSQVGTLSYMSPEAFMCNECDA
NGNTIKCGRPSDIWSLGCILYQMVYGRTPFAEYKTFWAKFKVITDPNHEITYESVPNPWL
LDLMKKCLAWDRSERWRIPQLLQHPFLVPPIPTQLSIPKEEDCKLLQLVAEACADNQEAS
KLWYDIRQLLKDPIASLTSQSLTSQNQQCKLLSQMSMLCFQLRECLSKLERE
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggacagggaggctaaccttccgaagaataatattgcacgtccgatcctcaactctgac
tcgacgtcgtcttcttcatcttctttctcttcctcctcctccccgccggaatttctccgg
catgttcaggccgccttcaagcgccaccgcgccctaggtaccatgcagacaaatagtcta
atgcctaggcggatattggttccgcaacgtgatacatctcaaactagcgcagcttcttct
gatgtttatcccaagaagtttcatgatgtcatcaatccatcaagtcaggttcaatctaga
aaagattcaagttcaactattatgcacaccaagaatccagtaattgctgttgttcgggaa
actccagaagatgcatcaattactcctcctcctatctcagccaccaccatcactaagacc
tttggagaaagttttaacgtccagagagatcaatctaaatcagctattgaatgcaaagag
aacaatccaatcccagcgtccttttcacatgtagagtctcaacatgttgacagcaagaga
aaggtccaattctcaatagcaaacaatgctacttcccaggaaatggaatgggacgcaagc
aatccagttgaggcattaaatgttatcaatgaggaatcaaagcatcggaattttcagaac
gtggattctgatgtttgtttgaggtctgatggtgcaggatctttattggcaaaaagaaca
atggcagttcaggaccaactgcaccaattacgaaactttttaagccaacctgttactcaa
tcttcagttattggcacatcatgtgccaccacaacatctgtccattctacttcagcaccc
atactaaactcaacaacctactgctcttgttcacatccagaaggtggaactcatgcggca
gtagaaccagcggttgagccactgggagatttaaatgcaagttctcagcatgcaagtcaa
aaaaatatggagcagctgtctaatccttcactgagggacacaagtgggatgctaattgac
cagacatctattgcggcccaaccttctacatccgttataaatgctcaaattaaggaacat
cctgtgcctagagaaaatgaaggccgtctggctaagggaactgacattcccaagaatcct
tcttatgtttgtgaaaagccaactaaagagcgagtatcagcagatgatgttactgatgta
cagcctcaggatccatcatccaaaaacccaccttcagatgtaaagttggagtcttctaaa
ccagaaaaacaagaaaaggttacaggtggtaaaggtgcttcagtgcctcgtaaaaagaat
tatgatcctgacttgttctttaaagttaatggaaagctctatcaaaggcttggtaagata
ggcagcggaggaagcagtgaggtccacaaagtcatttcttctgactgtacaatctatgca
ctcaagaaaatcaagctcaagggtcgtgactatgcaactgcatatggtttttgtcaggag
atcttgtacctcaacaaattgaagggaaagaacaacattatacagttgatagactatgag
gtgacagacaaaagtttgctccgtgaagtgatgaatgaatccatgagtaataaggatggg
agagttaaggatgatggttacatatacatggtccttgaatatggggaaattgatttggct
catatgctgtcgcagaaatggaaggaaatggatagcgcctatcagaccatagacgagaat
tggctcagattttactggcagcaaatacttcaggctgtcaacaccatacatgaggaacgc
atagtgcactctgacctgaagccagctaattttcttcttgtcaaaggttctctgaagttg
attgattttggtatcgctaaagccataatgagtgatacaaccaacatccaaagggattca
caggtgggtacactaagttacatgtctcctgaggctttcatgtgcaatgagtgtgatgca
aatggaaacaccataaagtgtggtcggccatcagacatttggtcgcttggctgcatactt
taccaaatggtatacgggagaaccccttttgctgagtacaagactttctgggcaaagttc
aaagttataacagatccaaaccatgaaataacttatgaatcagttcccaacccatggctt
cttgatcttatgaaaaaatgtctagcctgggatcgcagtgaaagatggagaattcctcaa
cttctccaacacccttttctcgttcctccaatccctacccaactatccattcctaaagag
gaagactgtaagctgcttcaacttgttgctgaagcttgtgctgataatcaggaagcttct
aagctctggtatgacatacgacaactacttaaggatccaattgcatctctaacatctcag
tcattaacatcacaaaaccagcagtgtaagttgttgtcccaaatgtctatgctttgcttt
caactgagggaatgtctgtcaaagttggagagggaatag

DBGET integrated database retrieval system