KEGG   Ricinus communis (castor bean): RCOM_1032900Help
Entry
RCOM_1032900      CDS       T01087                                 

Definition
myst histone acetyltransferase, putative (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     RCOM_1032900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 445 aa AA seqDB search
MGSIGTPPINPENGSSTSVPDGGQKSQSGVVDRIPPPAAEEMTMIESESLKKRKASILPL
EVGTRVMCRWRDGKYHQVKVIERRRMQCGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDS
VETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG
RYEIETWYFSPFPPEYNDSVKLYFCEFCLSFMKRKEQLQRHMRKCDLKHPPGDEIYRSGT
LSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKE
KHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYW
TRVLLDILKKHKGNISIKELSDMTAIKAEDILNTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGRGGLEVDVSKLIWTPYKEQG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggttccatagggacaccaccaataaatccagaaaacggctcatcaacgtcggtccca
gacggcggccaaaagtctcaatccggtgttgtagacagaatacctccacctgcggcggaa
gaaatgacgatgattgaatctgaatcattgaagaagagaaaggcgagtattctgcctctg
gaagtcggtactcgcgttatgtgccgttggagagacggcaagtaccaccaggtgaaggtc
atagaacggcgtaggatgcagtgcggtggtcctaacgattacgagtattacgtgcattac
acagagtttaataggaggcttgatgaatgggtgaagcttgaacaactagatcttgattca
gtggagactgttgttgacgagaaggttgaagacaaggttacaagcttgaagatgacacgc
caccagaaacgtaagattgatgagacacatgtggagggccatgaggagcttgatgctgcc
agcttgcgtgaacatgaggaattcacaaaagtaaaaaatatagccactattgaacttgga
agatatgagattgagacatggtatttctctccctttccaccagaatacaatgattctgtc
aagctgtacttttgtgagttttgcctcagttttatgaagcgtaaagaacagcttcaaagg
catatgaggaagtgtgatctcaagcatcccccgggtgatgagatttaccgaagtggtacg
ttgtcaatgtttgaggttgatggcaagaagaataaagtttatggacagaatctttgctat
ttggcaaaactgtttcttgatcataagaccctatactatgatgttgacctatttctattc
tatgttttatgtgaatgcgatgatcgaggatgccacatggttgggtacttttccaaggaa
aagcattcggaggaatcctataacttggcatgtattcttacccttcctccttaccaaaga
aaaggctatgggaaatttttaattgccttctcatatgaactttccaagaaagaaggtaaa
gttggcacacctgaaaggcctctttctgacttggggctgttgagctacagaggatactgg
acacgagttctcttggacatcttgaaaaagcacaagggaaatatttctatcaaggagctt
agtgacatgacagccatcaaggcagaggatattttgaacacccttcagagcctagaattg
attcaatacaggaaggggcaacatgttatctgtgcggatccaaaagtgttggatcgccat
ctaaaagctgctggtcgtggtggtcttgaggttgatgttagcaaattgatctggactcct
tataaagaacagggttga

DBGET integrated database retrieval system