KEGG   Ricinus communis (castor bean): RCOM_1033990Help
Entry
RCOM_1033990      CDS       T01087                                 

Definition
Homomeric Acetyl-CoA Carboxylase (Hom-ACCase) (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RCOM_1033990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCOM_1033990
   00640 Propanoate metabolism
    RCOM_1033990
  Lipid metabolism
   00061 Fatty acid biosynthesis
    RCOM_1033990
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    RCOM_1033990
Enzymes [BR:rcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RCOM_1033990
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RCOM_1033990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2259 aa AA seqDB search
MAMDVARGNGYVNGVVPTRSPATISEVDEFCYALGGKKPIHSILIANNGMAAVKFIRSVR
TWAYETFGTEKAILLVAMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAE
ITHVDAVWPGWGHASENPELPDALNAKGIVFLGPPAVSMAALGDKIGSSLIAQAADVPTL
PWSGSHVKIPPESCLITIPDEMYREACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRK
VHNDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDQYGNVAALHSRDCSVQRR
HQKIIEEGPVTVAPLVTVKKLEQAARRLAKCVNYVGAATVEYLYSMDTGEYYFLELNPRL
QVEHPVTEWIAEINLPAAQVAVGMGIPLWKIPEIRRFYGMEHGGGYNAWRKTSVATPFDF
DEAESTRPKGHCVAVRVTSEDPDDGFKPTSGKVQELSFKSKPNVWAYFSVKSGGGIHEFS
DSQFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYSIDLLHASDYKDNKIHTGWL
DSRIAMRVRAERPPWYLSVVGGALYKASASSAAMVSDYVGYLEKGQIPPKHISLVNSQVS
LNIEGSKYMIDMVRGGPGSYRLRMNESEIEAEIHTLRDGGLLMQLDGNSHVIYAEEEAAG
TRLLIDGRTCLLQNDHDPSKLIAETPCKLLRYLVSDGSHIEADTPYAEVEVMKMCMPLLS
PASGVIQFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFHGSFPLLGPPTAVSGKVHQRC
AASLNAARMILAGYDHNFDEVVQNLLNCLDSPELPFLQWQECLSVLATRLPKDLRNELES
KYKEFEGMSSSQNIDFPAKLLRGVLEAHLSSCPEKEIGAQERLVEPLMSLVKSYEGGRES
HARIIVQSLFEEYLSVEELFSDNIQADVIERLRLQYKKDLLKVVDIVLSHQGVRSKNKLI
LRLMEQLVYPNPAAYRDKLIRFSQLNHTSYSELALKASQLLEQTKLSELRSTIARSLSEL
EMFTEDGENMDTPKRKSAINERMEDLVSAPLAVEDALVGLFDHSDHTLQRRVVETYVRRL
YQPYLVKGSVRMQWHRSGLIASWEFLEEHIGRKNGSEDQMSDEPVVEKYSERKWGAMVII
KSLQFLPAIINAALRETAHNLHEAIPNGSMQSANFGNMMHIALVGINNQMSLLQDSGDED
QAQERINKLAKILKEQEVGSCLRTAGVGVISCIIQRDEGRAPMRHSFHWSAEKLYYEEEP
LLRHLEPPLSIYLELDKLKGYGNIKYTPSRDRQWHLYTVVDKPVPIKRMFLRTLLRQPTT
NEGFTAHQGLGVEVPRTQFDMSFTSRSILRSLVAAMEELELNVHNATVSSDHAHMYLCIL
REQQIDDLVPYPKRVDVDAAQEEAAVERILEELAREIHASAGVRMHRLNVCEWEVKFWIT
SSGQANGAWRVVITNVTGHTCAVHIYRELEDSSKHGVVYHSISIQGPLHGVLVNAIYQPL
GVLDRKRLLARRSSTTYCYDFPLAFETALEQIWASQLPGTEKPKDNSLLKVTELVFADQK
GSWGTPLVPMERPAGINDVGMVAWCMEMSTPEFPSGRTVLIVANDVTFKAGSFGPREDAF
FFAVTDLACTKKLPLIYLAANSGARIGVAEEVKSCFRVCWSDESSPERGFQYVYLSSEDY
NDIGSSVIAHELNLPSGETRWVIDAIVGKEDGLGVENLSGSGAIASAYSRAYKETFTLTY
VTGRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNG
VVHLTVADDLEGVSAILKWLSCTPPYVGGTLPVLCPVDPTERPVEYFPENSCDPRAAISG
VLDGNGKWLGGIFDKDSFVEILEGWARTVVTGRAKLGGIPVGVIAVETQTVMQVIPADPG
QLDSHERVVPQAGQVWFPDSATKTAQAILDFNREELPLFILANWRGFSGGQRDLFEGILQ
AGSTIVENLRTYKQPVFVYIPMMGELRGGAWVVVDSQINSDHIEMYADRTAKGNVLEPEG
MIEIKFRTKELLECMGRLDQQLIAWKAKLQEARNSGTYGVFESIQQQIKSRERQLLPVYT
QIATRFAELHDSSLRMAAKGVIREVVDWGRSRTYFYKRLCRRIAEGEMIKTVKDAAGHQL
SHKSAIDLIKNWFLESDIASGKADAWEDDEAFFAWKDVPGNYEEKLQELRIQKVLLQLTN
IGESMLDLKALPQGLAALLEKVEPSSRGLLIDELRKVLN
NT seq 6780 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggatgttgcacgtgggaatggttatgtaaatggggtggttccaacaaggagc
cctgccaccatatctgaagtggatgagttctgctatgctcttggaggaaagaaaccaatc
cacagtattttaattgcaaacaatggaatggcagctgtcaaatttattcgcagtgttagg
acatgggcttatgaaacatttggcactgagaaagcaatcttattggtggccatggctact
ccagaagacatgagaatcaatgcagagcatatcagaattgctgatcagtttgtggaagtt
cctggtgggacaaataacaataactatgccaatgtgcagctcattgtagagatggcagag
ataacccatgtcgatgcagtttggcctggttggggtcatgcatctgagaaccctgagctg
ccagatgcactaaatgcaaaggggatagtatttcttgggcctccggctgtatcaatggca
gcattgggtgataaaattggctcatctttaattgcccaagcagcggatgtcccgactctt
ccatggagtggctctcatgtgaaaattcctccagaaagttgtttgattaccatcccagat
gagatgtacagggaagcatgtgtatatacaacggaggaagcgattgcaagttgtcaagtt
gttggttaccctgcaatgatcaaggcatcatggggtggtggtggtaaaggcataagaaag
gttcataatgatgatgaagttagggcattgttcaagcaagtccaaggtgaagttcctggg
tcgcccatctttataatgaaggttgcttcccagagtcgacacttggaagtccagttactc
tgtgatcagtatggaaatgtagcagctttgcatagccgtgattgcagtgttcagaggcga
caccagaaaataattgaggaaggtccagttaccgttgcaccgctggtaacggttaaaaaa
ctggagcaggcagctcgaaggttggcaaaatgtgtgaattatgttggagcagctacagtt
gagtatttgtacagtatggatactggagaatattattttttggagctcaacccccggtta
caggtggagcaccctgtcactgagtggattgctgaaattaatttgccagcagcccaggta
gctgttgggatgggaattcccctctggaaaattcctgagataagacgcttttatggaatg
gaacatggtggaggatataatgcttggaggaaaacttcagttgctactccttttgatttt
gacgaggcggagtccacaagaccaaaaggtcattgtgtagctgtgcgtgtgacaagcgag
gatccagacgatggctttaagcctaccagtggtaaagtgcaggagctgagttttaaaagc
aagccaaatgtgtgggcttacttctctgttaagtctggtggtggcattcatgaattctca
gattctcaatttggacatgtttttgccttcggggagtcgagagctttggctatagcaaat
atggtccttgggctgaaagaaattcaaattcgaggagaaatccgtaccaatgttgactac
tcaattgaccttttacatgcttctgattataaagacaataaaattcacacaggttggttg
gacagcagaattgctatgagggttagagctgaaaggcccccgtggtacctctctgttgtt
ggaggggctctttacaaagcatccgctagcagtgcagctatggtttcagattatgttggt
tatcttgaaaaggggcaaatccctcccaagcacatatcacttgtgaactctcaagtttct
ttgaacattgaaggaagcaaatacatgattgacatggttagaggtgggccagggagctat
agattgaggatgaatgaatcagagattgaagcagagatacatactttacgtgatggaggt
ttattgatgcagttggatggaaacagccatgtgatatatgcagaggaagaggctgctgga
actcgtcttctcattgatggaaggacttgcttgctacagaatgatcatgatccatcaaag
ttaatagcggaaacgccatgcaagctgttaagatatttggtttcagatggtagtcatatt
gaagctgacaccccatatgcagaggtcgaagttatgaagatgtgcatgcctcttctttca
cctgcttctggagttattcagtttaaaatgtctgaaggtcaagcgatgcaggctggtgag
cttatagcacgacttgatcttgatgatccttcagctgtacgtaaggctgagccttttcac
gggagcttcccactactggggcctccaactgctgtttctggtaaggttcatcagagatgt
gctgcaagtctaaatgcagctcgtatgattcttgctggctatgatcataattttgatgaa
gtagtgcaaaacttgctcaattgtcttgatagtcctgaacttcctttccttcagtggcaa
gagtgcttatctgtattggcaactcgccttcccaaagatcttagaaatgagctggaatca
aagtataaggagtttgaggggatgtcaagctcccagaacattgacttcccagccaaattg
ctaaggggtgttcttgaggctcatttatcctcctgtcctgaaaaagaaataggagcccag
gaaaggcttgttgaacctttaatgagccttgtgaagtcttacgagggaggacgggaaagt
catgcccgaatcattgttcagtcactttttgaagagtatttatccgttgaagaattgttt
agtgacaatatccaggctgatgtcattgaacgtcttagacttcaatataagaaagatcta
ctgaaggttgtggacattgtcctttctcatcagggtgtccggagtaaaaataagctgata
ctacggctcatggaacaactggtttaccctaacccagctgcttatagggataaactaatt
cggttctctcaacttaaccatacaagttattctgagctggcactgaaagcaagtcaactg
ctagaacaaaccaaactgagtgaacttcgttccaccattgccagaagtctttctgaacta
gagatgtttactgaggatggtgaaaatatggatactcccaagaggaaaagtgccattaat
gaacgaatggaggatcttgtgagcgctcctttggctgttgaagatgcccttgtgggtctg
tttgatcacagtgatcacacccttcaaaggcgggttgtggaaacttatgttcgtaggctg
tatcagccctatcttgtaaagggaagtgtcaggatgcaatggcatagatccggtcttatt
gcttcatgggagttcttggaagagcatattgggagaaaaaatggctctgaagatcaaatg
tcagatgaaccagtggttgagaaatacagtgaaaggaaatggggagccatggttatcata
aaatctctacaatttttgcctgcaatcattaatgctgcattaagggaaacagcccataac
cttcatgaagcaattccaaatggatccatgcaatcggctaactttggcaatatgatgcat
attgcattggtggggatcaacaaccagatgagtctgcttcaggacagtggggatgaggat
caggctcaagagagaattaacaagttagccaaaattcttaaagagcaagaagtaggctcc
tgtttacgcactgcaggtgttggggttattagctgtatcatacagagggatgaagggaga
gcccctatgaggcattcctttcactggtcagcagaaaagctctattacgaggaagagcca
ttactgcgacatctagaacctccactgtccatctaccttgaactggacaaacttaaaggt
tatgggaacataaaatacactccatcgcgtgacagacaatggcacttgtacactgttgta
gataagccagtgccaatcaagaggatgtttcttagaactcttctgaggcagcccacaaca
aatgaagggtttactgcacatcaagggctaggtgtggaagttcctcgtactcaatttgac
atgtcctttacatcaaggagcattttgaggtctttagtggctgcaatggaggagttggag
cttaatgtgcacaatgctactgtcagttctgaccatgctcatatgtatctctgtatcttg
agagaacaacaaatagatgatcttgtgccttatcccaagagagttgatgtagatgccgcc
caggaagaagctgccgttgagagaatcttggaagaactagctagggaaatacatgcatca
gctggtgtaagaatgcataggttaaatgtttgcgagtgggaagtgaagttctggataaca
tcatctggtcaggcaaatggggcttggagagttgtcatcacaaatgtgactggtcataca
tgtgcagtacatatatatagagaactagaggattccagcaaacatggagtggtctaccat
tcaatctctatacagggtcctctgcatggtgtattggtaaatgcaatctatcagcccttg
ggagttcttgatcggaaacgtttgctggcaaggagaagcagcaccacttactgctatgat
tttccattggcatttgagacagccttagaacaaatatgggcttcccagttaccaggaact
gaaaaacccaaggataattctcttcttaaagtcacagagctcgtatttgctgatcagaaa
ggaagctggggtactcctcttgttcccatggagcgcccagccggaatcaatgatgttggc
atggtagcatggtgcatggagatgtcaacccctgagttcccttctggaaggacagtattg
atagtagcaaatgatgtaaccttcaaagctgggtcttttggtccaagagaggatgcattc
ttctttgcagtaaccgatcttgcttgcactaagaagctgccattgatttatcttgcagca
aactctggcgctcgaattggtgttgctgaggaagtcaagtcctgctttagagtatgttgg
tctgatgaatcaagcccagagcgtggctttcagtatgtatatctgagttctgaggattat
aatgacattggatcatctgttatagcacatgagttgaatctgcctagtggagaaaccaga
tgggtgatagatgccattgttggaaaggaggatggcctgggggtagagaacttatctgga
agtggggccattgctagtgcatattctagggcatacaaagaaacctttaccttaacatat
gtgactggcagaacagtgggaattggagcttacctagctcgccttgggatgcgttgcata
cagagactggatcagcccattatattgactggtttctctgctttgaacaaactcctcggc
cgtgaggtgtatagctctcacatgcaacttggtggacctaagattatggcaactaatggg
gtagtgcatcttactgttgcagatgatctagaaggtgtttcagctattttgaagtggcta
agctgtactcctccttatgtgggaggtacgcttccggttttatgtcctgtggatccaact
gaaaggcctgtggagtacttccctgaaaactcatgtgatccacgagctgctatttctggt
gttttggatggtaatggaaagtggcttgggggtatttttgacaaggatagctttgttgag
atactggaagggtgggcaaggactgttgtgactggacgggcaaaacttggaggaattcct
gtcggagtaatagctgttgagacacaaactgtaatgcaagtgattcctgctgacccagga
cagcttgattcccacgagagggtagtccctcaggctggacaagtatggtttccagattct
gcaaccaaaacagctcaggcaattttggatttcaacagagaagagcttccacttttcatt
cttgctaactggagaggcttttccggtggacagagggacttgtttgaaggtatccttcag
gctggttcaaccatagttgagaaccttaggacatacaagcaacccgttttcgtatacatc
cccatgatgggtgagcttcgtggtggggcatgggtcgttgtggacagtcagatcaattca
gaccacatcgaaatgtatgcagatcgaactgctaaaggtaatgtccttgagccagaagga
atgatcgagatcaagttcaggacaaaggagttgcttgagtgcatgggtaggcttgatcaa
cagctgatcgcttggaaggcaaaacttcaggaagccaggaatagtggaacttatggggtc
tttgaatctatacagcagcaaataaaatctcgtgaaaggcaacttttaccagtttacaca
cagatagccaccagattcgcagagcttcatgattcttccctaaggatggctgcaaaaggg
gtcatcagagaagttgttgactggggtagatcccgcacttacttctacaaaaggttatgt
aggagaattgccgagggtgaaatgatcaagacagtaaaagatgcagctggtcaccagctg
tcacataaatctgctatagacttgatcaaaaattggttcttggaatcagatattgcaagt
ggcaaagcagacgcgtgggaggatgatgaagctttctttgcatggaaggatgttccagga
aactacgaagaaaagctacaggagttacggatccagaaggtgttgcttcaattgacaaac
ataggtgaatctatgttagatttgaaagctctacctcaaggtcttgctgcccttctagaa
aaggtggagccatcaagccgagggctgttgattgatgagctccggaaggtgctcaattga

DBGET integrated database retrieval system