KEGG   Ricinus communis (castor bean): RCOM_1034140Help
Entry
RCOM_1034140      CDS       T01087                                 

Definition
phosphoglycerate mutase, putative (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rcu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rcu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rcu00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rcu00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MASAVFHQSIGTLQSHQHLHNSGFNQEFQNISVKLISKCSKVDMGLSMSRKGEFCSAKRN
FHVVQASASQTSVVDPVSTPSNGSTNEIKNKSSEAALILIRHGESLWNEKNLFTGCVDVP
LTKKGVEEAIEAGKRISNIPVDMIYTSALIRAQMTAMLAMTQHRRRKVPIVMHNESEQAR
AWSQIFSEDTLKQSIPVITAWQLNERMYGELQGLNKQETADRFGKEKVHEWRRSYDIPPP
NGESLEMCAERAVAYFKDQIEPQLLSGKNVMIAAHGNSLRSIIMYLDKLTSQEVISLELS
TGIPMLYIFKEGRFIRRGSPAAPTEAGVYAYTRRLAQYRQKLDEMLH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgctgtgtttcaccaatcaatagggactcttcaatcccatcaacatctccat
aactctggatttaatcaggagtttcagaatatttcggtgaagttgatttcaaaatgttct
aaggttgatatgggattgtcaatgtcaagaaagggggaattttgctctgctaagaggaat
tttcatgttgttcaagcctcagcttctcaaacttcagtagttgatcctgtttcaaccccc
tcaaatggcagcacaaacgaaattaaaaataaatcaagcgaggcagctctaatactgatt
aggcatggtgaatcattatggaacgagaagaacctgttcacgggttgtgttgatgttcca
ttaacaaagaagggtgtggaagaggcaattgaagctggtaagagaatcagtaacatacct
gtcgacatgatatatacatcagccctgattcgcgcacaaatgactgctatgctcgccatg
acccagcatcgtcgtagaaaggtgccgatagttatgcacaatgagagtgagcaggcaagg
gcatggagtcaaatctttagtgaagacacattaaagcaatccattccagttataacagct
tggcaattaaatgaaagaatgtacggggaattgcaaggtctgaataagcaggaaacagca
gacagatttggaaaagaaaaagttcacgagtggaggagaagttatgacatacctccacca
aacggtgagagtttggaaatgtgcgctgaaagagctgttgcttattttaaagatcagatt
gaaccccagcttctttctgggaagaatgtgatgattgctgcccatgggaactcgttgagg
tccattattatgtatctggacaaattaacctcccaagaggtcataagtttagaactatca
accggaatacctatgctttacattttcaaagagggcaggtttattaggaggggaagccct
gcagcaccaactgaggctggggtctatgcatatactaggagattagctcaatacaggcag
aagttagatgagatgttgcattag

DBGET integrated database retrieval system