KEGG   Ricinus communis (castor bean): RCOM_1034140Help
Entry
RCOM_1034140      CDS       T01087                                 

Definition
phosphoglycerate mutase, putative (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_1034140
   01230 Biosynthesis of amino acids
    RCOM_1034140
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_1034140
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCOM_1034140
Enzymes [BR:rcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RCOM_1034140
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RCOM_1034140
  Exosomal proteins of melanoma cells
   RCOM_1034140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MASAVFHQSIGTLQSHQHLHNSGFNQEFQNISVKLISKCSKVDMGLSMSRKGEFCSAKRN
FHVVQASASQTSVVDPVSTPSNGSTNEIKNKSSEAALILIRHGESLWNEKNLFTGCVDVP
LTKKGVEEAIEAGKRISNIPVDMIYTSALIRAQMTAMLAMTQHRRRKVPIVMHNESEQAR
AWSQIFSEDTLKQSIPVITAWQLNERMYGELQGLNKQETADRFGKEKVHEWRRSYDIPPP
NGESLEMCAERAVAYFKDQIEPQLLSGKNVMIAAHGNSLRSIIMYLDKLTSQEVISLELS
TGIPMLYIFKEGRFIRRGSPAAPTEAGVYAYTRRLAQYRQKLDEMLH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgctgtgtttcaccaatcaatagggactcttcaatcccatcaacatctccat
aactctggatttaatcaggagtttcagaatatttcggtgaagttgatttcaaaatgttct
aaggttgatatgggattgtcaatgtcaagaaagggggaattttgctctgctaagaggaat
tttcatgttgttcaagcctcagcttctcaaacttcagtagttgatcctgtttcaaccccc
tcaaatggcagcacaaacgaaattaaaaataaatcaagcgaggcagctctaatactgatt
aggcatggtgaatcattatggaacgagaagaacctgttcacgggttgtgttgatgttcca
ttaacaaagaagggtgtggaagaggcaattgaagctggtaagagaatcagtaacatacct
gtcgacatgatatatacatcagccctgattcgcgcacaaatgactgctatgctcgccatg
acccagcatcgtcgtagaaaggtgccgatagttatgcacaatgagagtgagcaggcaagg
gcatggagtcaaatctttagtgaagacacattaaagcaatccattccagttataacagct
tggcaattaaatgaaagaatgtacggggaattgcaaggtctgaataagcaggaaacagca
gacagatttggaaaagaaaaagttcacgagtggaggagaagttatgacatacctccacca
aacggtgagagtttggaaatgtgcgctgaaagagctgttgcttattttaaagatcagatt
gaaccccagcttctttctgggaagaatgtgatgattgctgcccatgggaactcgttgagg
tccattattatgtatctggacaaattaacctcccaagaggtcataagtttagaactatca
accggaatacctatgctttacattttcaaagagggcaggtttattaggaggggaagccct
gcagcaccaactgaggctggggtctatgcatatactaggagattagctcaatacaggcag
aagttagatgagatgttgcattag

  All links  
No link information was found.   
DBGET integrated database retrieval system