KEGG   Ricinus communis (castor bean): RCOM_1039620Help
Entry
RCOM_1039620      CDS       T01087                                 

Definition
cytochrome P450, putative (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 692 aa AA seqDB search
MSFSGSDLVRYIESVLGVELGGSPMSDSVVVIITTSFAVIIGLLVFLWKRSSDRSKEVTP
LVVPKSLSVKDEEDEAETLAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD
LDDYAMDDDQYEEKLKKETLTFFMVATYGDGEPTDNAARFYKWFTEEHERGVWLQQLTYG
IFGLGNRQYEHFNKIAKVLDEQLNEQGAKRLIPVGLGDDDQCIEDDFTAWRELLWPELDN
LLRDEDDVNGASTPYTAAIPEYRVVIHDASATSCEDKSVLENGNTSIDIHHPCRVNVAVQ
KELHKPESDRSCIHLEFDISGTGIIYETGDHVGVYAENFEENVEEAGKLLGQPLDLLFSI
HADNEDGAPLGSSLAPPFPGPCTLRTALSHYADLLNPPRKAALIALAAHASEPSEAERLK
YLSSPEGKDEYSQWIVGSQRSLLEVMAEFPSARPPLGVFFAAIAPRLQPRYYSISSSPRF
ALSRVHVTCALVYGPTPTGRIHKGVCSTWMKNAVPLEKSHDSSWAPVFIRTSNFKLPTDP
SIPIIMVGPGTGLAPFRGFLQERMALKEDGAQLGPALLFFGCRNRRMDFIYEDELNYFVE
QGVISELIVAFSREGPQKEYVQHKMMDKAAQIWSLISERGYIYVCGDAKGMARDVHRTLH
TIVQEQGNLDSSKTESMVKKLQMDGRYLRDVW
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttcgggttcggatttggttaggtatattgagtcagtactgggagttgaactg
ggagggagtccaatgtctgactccgttgttgttataattactacgtcgtttgcggttatt
ataggattgttggtgtttttatggaagagatcatcggatcggagcaaagaggtaacgcct
ctggtggttccaaagtcactttctgtgaaagatgaggaggatgaagctgagactcttgct
ggtaagactaaagttactatcttttacggtactcagactggtactgccgagggatttgct
aaggccttagctgaggagattaaggcaagatatgagaaagcagctgttaaagttgttgac
ctggatgattatgcaatggatgatgaccagtatgaagaaaaattgaagaaggagactttg
acttttttcatggttgccacttatggagatggagagccaactgataatgctgcaagattc
tataagtggtttactgaggaacatgaaaggggagtatggcttcaacagctcacttatggc
atttttggcttgggtaatcgtcaatatgaacactttaataagatagcaaaggtgcttgat
gaacaacttaacgaacaaggagcaaaacgccttattcctgttggtctgggagacgatgat
caatgcattgaagatgattttactgcttggcgagagttattgtggcctgagttagacaat
ttacttagagatgaagatgatgtgaatggtgcatctactccttatacagctgctattcct
gaataccgggtggtaattcatgatgcttctgcaacatcttgtgaggataaatcagttttg
gaaaatggaaatacttctatcgatattcaccatccatgcagagttaatgtggccgttcaa
aaagagctccacaaaccagaatctgacaggtcatgcatacatttggagttcgatatatca
gggactggcattatatatgaaactggggaccatgttggtgtttatgctgaaaactttgaa
gaaaatgtggaagaagcagggaagttgttgggtcaacctttagatttgctattttctatt
catgctgacaatgaagatggagcacccctaggaagctcattagctcctccattcccaggg
ccttgcacactccgcactgctttgtcacattatgcagatctcctgaatcctccacgaaag
gctgctttgattgctttggctgctcatgccagtgaacctagtgaggctgagagactcaag
tatttatcgtcgccagagggcaaggacgagtactctcagtggattgttggcagtcagaga
agtctccttgaggtaatggctgagttcccatctgcaagacctcctcttggtgtatttttt
gcagcaattgctcctcgtctacaacctcgctactattctatctcatcctctcctagattt
gcactcagtagagtacatgtgacttgtgctttggtctatggtccaacgccgactggtaga
attcacaaaggggtgtgctcaacctggatgaagaatgcagttcctttggagaaaagccat
gactctagttgggctcccgtttttattaggacatctaatttcaagttaccaaccgatcct
tcaattccaattatcatggtgggccctggtactggattggcaccattcagaggatttctt
caggaaagaatggccctgaaagaggatggtgctcagcttggtcctgctctgctcttcttt
ggatgtagaaatcgccgaatggatttcatatatgaggatgagctcaactactttgtcgaa
caaggtgtgatatctgagctgattgttgcattctcaagggaaggaccacaaaaggagtat
gttcagcataagatgatggataaagcagcacaaatttggagcctaatttctgagagggga
tatatttatgtatgtggtgatgccaagggtatggcgagggatgttcatcggactttgcat
actattgttcaggagcagggaaatttagattcatctaagacagagtctatggttaagaag
ctacagatggatggacgatatcttagagatgtctggtga

DBGET integrated database retrieval system