KEGG   Ricinus communis (castor bean): RCOM_1045330Help
Entry
RCOM_1045330      CDS       T01087                                 

Definition
histidinol dehydrogenase, putative (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCOM_1045330
  Amino acid metabolism
   00340 Histidine metabolism
    RCOM_1045330
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RCOM_1045330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 479 aa AA seqDB search
MDSQLLCFNRTNCLVSPYSPIRSSLITAQVHKGLSLNRIRCAMKSYRLSELTRTEVDSLK
ARPRIDFSSIFSIVNPIVDGVRSRGDAAVKEYTARFDKVNLENIVENVSELPEMEIDAAV
REAFDVAYDNIYAFHLAQKAAEKSVENMKGVRCKRVARSISSVGLYVPGGTAVLPSTALM
LAIPAQIAGCKTVVLATPPTQEGIICKEVLYCAKKAGVTHILKAGGAQAISAMAWGTESC
PKVEKIFGPGNQYVTAAKMILQNSEAMISIDMPAGPSEVLVIVDSQASPVHIAADLLSQA
EHGPDSQVVLVIVGDDVNLKAIEEEISKQCQSLPRGEYASKALGHSFIVFARDMVEAISF
SNLYAPEHLIVNVKDAEKWESFIENAGSVFLGPWTPESVGDYASGTNHVLPTYGYARMYG
GVSLDSFLKYMTVQSLTEEGLRNLGPYVATMAEVEGLEAHKRAVTLRLQDIEARQVHNV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggattctcagctgctgtgctttaaccggaccaactgcttagtgtcaccatactctcct
attcgatcttcattgattactgctcaggtgcacaaaggattaagtttgaacagaataagg
tgtgcaatgaagtcttatcggttatctgaacttactcgtacagaggttgacagcttgaaa
gctcgtcctcgaatagatttctcttcaatcttcagcatagtcaatcccattgttgatggc
gttcgcagcagaggtgatgctgctgttaaagagtatactgcaaggtttgacaaggtcaac
ttggagaacattgttgagaatgtatctgaacttcctgagatggagattgatgcagctgta
agggaagcatttgatgtggcatatgacaatatttatgcatttcatcttgctcaaaaagca
gctgaaaaaagtgttgagaacatgaaaggtgtcagatgtaaacgggtggcaaggagcatt
tcttctgtaggtctctatgttccagggggaactgcagttttaccttcaacagctctgatg
cttgcaattcctgcacagattgctggatgtaagactgttgttcttgcaactcctccaact
caggaaggcatcatatgtaaggaggtactgtactgtgccaaaaaggctggtgtcactcac
atccttaaagctggaggagctcaggctatatcagccatggcatgggggacagaatcttgc
cctaaggtagagaagatttttggaccagggaatcagtatgttacagctgccaaaatgata
cttcaaaacagtgaagcaatgatctcaattgacatgcctgctggaccttcagaagtttta
gttattgttgacagtcaagccagtcctgtacatatagctgcagatttactctcgcaggct
gaacatggccctgatagccaggttgttcttgtaattgttggagatgatgtgaatctgaaa
gccattgaagaggaaattagtaagcaatgtcaaagcctaccaagaggagaatatgcttca
aaagcactgggccatagtttcattgtatttgctcgtgatatggttgaggccatctccttt
tcaaacttatatgcacctgagcatctgatcgttaatgtaaaagatgcagaaaagtgggaa
agttttattgagaatgcaggttctgtgttcttgggaccgtggacaccagagagtgttgga
gattatgcgagcgggacaaaccatgtcctaccaacttatggatatgcaagaatgtatggc
ggggtatccttagactctttcctcaaatacatgacagtacaatctttgacagaggaaggt
ttgagaaaccttggtccgtatgtggcaacaatggctgaagttgaaggactagaagcacac
aagagagctgtaactctacgacttcaggatattgaagccagacaagttcacaatgtgtga

DBGET integrated database retrieval system