KEGG   Ricinus communis (castor bean): RCOM_1048220Help
Entry
RCOM_1048220      CDS       T01087                                 

Definition
histone acetyltransferase type B catalytic subunit, putative (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 460 aa AA seqDB search
MGQKQQSTGDPTTEPKKRRRVGFSNVDSGIEANECITIYMVSSREQVGASDSFCISPVDL
NGFFDEAGKIYGYQGLKITIWISSLTFHAYADITYESTSDGGKGITDLKNALQRIFAETL
VENKDDFLRSFSAESHLIRSIVSTGEIFHHKASNGYIGESHLGEPTSDMKVFRMAIGNTG
AGHLYSRLIPLVLLLIDGSNPIDVADPGWELFVLIHEKNDEQGDIQHRLLGFTAVYRFYH
YPDKTRLRLSQILVLPPYQHKGYGRQLVEVVNKVAISEDVYDFTVEEPLDHFQHVRTCVD
IQRLLAFDAIQDAINSAVSNLKQGKLSKRAHVPRFIPPSTAIDAVRKTLKINRKQFLQCW
EVLIYLGLDSEDKGMEDFATIISNRVKADILGKDSGSGGKQVIEVPSYYNPEMSFVMFRS
GSEGSIQMDENQTNQKEQLQQLVDERLKEIKLIAQKLRPV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaagcaacaatcaaccggcgatccgaccaccgaacccaagaaacgaaggcgt
gttggcttctcgaacgtcgattctggaatcgaggccaatgaatgcattacaatttacatg
gtttctagcagggaacaagtgggtgcttcagacagtttctgcatttccccagttgacctg
aatggctttttcgatgaggctgggaaaatttatggctatcaggggttaaagataacaatc
tggattagcagcttaacatttcatgcatatgctgatattacatatgagagcacatctgat
ggaggtaaagggatcactgacctcaaaaatgctcttcagagaatttttgctgagactctt
gtggagaataaggatgatttccttcgatcattttctgcagagagtcatttgattagatcc
atcgtctcaactggggagatattccatcataaagcctcaaatggatacattggtgaaagt
catttaggagaacctacatccgatatgaaggttttccgcatggcaataggcaatacaggt
gctggacacctttacagtcgcttgatccctcttgttcttcttcttattgatgggagcaac
cctattgatgtagctgatccaggatgggagttatttgtcctgatccatgagaaaaatgat
gagcagggggacattcaacataggctgctaggttttacagcagtttatcgcttctatcat
taccctgataaaacacgactacgactcagtcagatcttggtgctgcctccttaccaacac
aaaggttatggtcgtcaacttgttgaggtggtcaacaaagtcgccatatctgaagatgtt
tatgacttcacagttgaagagccactagatcacttccaacacgtgcgcacttgtgttgac
atacaacggctgcttgcatttgatgcaatccaagatgcaattaattcagctgtttcaaat
ttgaaacagggaaagttatcaaagagagcgcatgtccctcgattcattccaccttcaact
gcaatagatgctgttaggaaaactttgaaaatcaacaggaaacagtttcttcagtgctgg
gaggtactaatttatctaggccttgattctgaagataagggcatggaggattttgcgaca
atcatttcaaatcgtgtgaaggctgatatattaggaaaagactctggaagtggtggaaag
caggtgattgaagtcccgagttactataatccagagatgtcatttgtcatgttcaggtca
gggagtgaaggcagtattcagatggatgaaaatcaaacaaatcaaaaggagcagctgcaa
caattggttgatgaaaggctcaaagaaataaagctaattgcacagaagttgcgtcctgtc
taa

DBGET integrated database retrieval system