KEGG   Ricinus communis (castor bean): RCOM_1049070Help
Entry
RCOM_1049070      CDS       T01087                                 

Definition
mitogen activated protein kinase kinase, mapkk2, putative (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    RCOM_1049070
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     RCOM_1049070
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   RCOM_1049070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 355 aa AA seqDB search
MKIKKPLQQLKLSVPTQETPITSFLTASGTFHDGDLLLNQKGLRLINENNESRGITEIKE
VDIEFSLEDLETIKVIGKGSGGVVQLVRHKFIGTFFALKVIQMNIQEEIRKQIVQELKIN
QASQCTHVVVCHHSFYHNGAISLVLEYMDRGSLADVIRQVKTILEPYLAVVCKQVLQGLL
YLHNERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLANSMGQRDTFVGTYNYMSPERIS
GSTYDYSSDIWSLGLVVLECAIGRFPYMQSEDQQSGPSFYELLEAIVESPPPSAPPDQFS
PEFCSFVSACLWKNPQDRASSLDLLSHPFIKKFEDKDIDLEILVGSLEPPVNYPR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaagaagccattgcagcaactgaagctctctgttcctactcaagagactccc
atcacttccttcttaactgccagcggtacatttcatgacggagatttgcttttgaatcag
aaaggtttgcgactcatcaatgaaaataatgaatctcgtggtattacagagataaaggag
gttgatattgaattttcattggaagatcttgagacaattaaagtgattggaaagggaagt
ggaggtgttgtccaacttgttcgtcataaattcattgggacattttttgctctcaaggtt
atccagatgaatatacaagaggaaattcgcaaacaaattgtacaggagctgaaaataaac
caagcctcacaatgtactcatgttgttgtttgtcaccactcgttctatcacaatggagct
atttcgcttgtgttagaatacatggaccgtgggtctcttgcagatgtcattagacaagtt
aaaacaattcttgaaccttatctcgcggttgtctgtaagcaggtgttacaaggactttta
tacttgcacaatgaacgacatgtcatacatagggacattaaaccatccaatcttttagtg
aaccataagggggaagtgaagatcactgattttggtgtgagtgcaatgctggctaattct
atgggtcaaagggacacttttgttggaacttataattacatgtcgccagagcgaattagt
ggaagtacctatgattatagcagtgatatctggagtttaggcttggtagtacttgagtgt
gctatagggcggtttccttatatgcaatctgaagatcaacaaagtggcccaagcttttat
gaacttctggaagccattgtagaaagcccaccaccatctgctccgccagatcagttctct
ccggagttctgttcatttgtatctgcctgtttatggaagaatcctcaagacagggcatca
tctttagacctcctgagtcaccctttcatcaagaagtttgaagacaaagacatagatctt
gaaattctggtaggcagcttggaacctcctgtgaactaccctagatag

DBGET integrated database retrieval system