KEGG   Ricinus communis (castor bean): RCOM_1049540Help
Entry
RCOM_1049540      CDS       T01087                                 

Definition
hexokinase, putative (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_1049540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_1049540
   00051 Fructose and mannose metabolism
    RCOM_1049540
   00052 Galactose metabolism
    RCOM_1049540
   00500 Starch and sucrose metabolism
    RCOM_1049540
   00520 Amino sugar and nucleotide sugar metabolism
    RCOM_1049540
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    RCOM_1049540
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     RCOM_1049540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MGKVAVGAAAVCAAAVCASAALVVRHRMKSSGRWTRAMAILGEFEEKCGTPVGKLRQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKEDR
VVKQEFEEVSIPPHLMIGSSDALFDFIADALKKFVATEGEDLHPLPGQQRELGFTFSFPV
RQASIASGTLIKWTKGFSIEDTVGEDVVGELTKAMDRVGLDMRVAALVNDTIGTLAGGRY
HSQDVIAGVILGTGTNAAYVERAQAIPKWHGLLPKSDEMVINMEWGNFRSSHLPLTEYDE
ALDIESLNPGEQIFEKIISGMYLGEIVRRVLLKMAEEANLFGDVVPPKLEIPFILRTPVM
SAMHQDTSSDLRVVGSKLKDILEIPNTSLKTRKAIVKLCDIVATRGARLSAAGIVGILKK
LGRDTIKEREKHKSVIAMDGGLFEHYTKFRVCLESTIEELLGKEVSENIVVEHSNDGSGI
GAALLAASHSLYREVAEY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcggccgtgtgtgcagcggcggtgtgtgcgtcggcg
gcactagtggtgaggcataggatgaagagctcaggaaggtggaccagagccatggcgata
cttggagagtttgaagagaagtgtggcacccctgtcggaaaattaagacaggtggcagat
gctatgaccgtcgagatgcatgctggtcttgcatcggagggtggtagtaaacttaagatg
atcattagctacgttgataatcttcctaccggggatgagaaggggctgttttatgcatta
gaccttggtggcacaaattttcgcgtcttacgtgtacttttgggagggaaagaagatcgt
gttgtcaaacaagaatttgaggaagtttctattcctccacacttgatgattggatcttca
gatgcattattcgattttattgcggacgcacttaaaaagtttgttgctacagaaggtgaa
gacttgcaccctttgcctggtcaacaaagggaactgggctttaccttctcattcccagtt
aggcaagcgtcaatagcatcaggaactcttataaaatggacaaaaggtttctctatagaa
gatacagttggggaagatgtggtaggagaattgacaaaagccatggacagagttggtctt
gacatgcgtgttgcagctttggtcaatgatacaattggaacattagctggaggtagatac
cacagccaggatgttattgctggagtaatcttgggcactggaacaaatgcagcctatgta
gaacgggcacaagcaattcccaagtggcatggtcttctacctaaatcagatgaaatggta
atcaatatggagtggggtaacttccgatcatcacaccttccacttacagaatatgatgag
gctctggatattgagtctctgaacccaggggaacagattttcgagaagatcatttctggt
atgtatttgggagagattgtacggagagttctgttgaagatggccgaggaagctaacctt
tttggtgatgttgttccaccaaaactggagattccattcattctaaggactcctgtcatg
tcagctatgcatcaagatacatcttcagatctgagagtcgttggaagcaaactaaaggat
atcttagagatacctaatacctctctgaaaacgaggaaagctatagttaagctttgtgac
attgttgccactcgtggtgcccgcctctctgcagccggaatagtaggcatactcaagaaa
ttgggaagagacacaataaaggaaagggaaaagcataagtcagtaatagcaatggatgga
gggctttttgagcactacactaagtttcgtgtatgcttggagagcacgattgaggagttg
ctgggaaaggaagtttctgagaacattgttgttgagcactcaaatgatggctcaggcatc
ggagcagctctgctggcagcttcccactccctataccgggaggttgctgaatactga

DBGET integrated database retrieval system