KEGG   Ricinus communis (castor bean): RCOM_1049540Help
Entry
RCOM_1049540      CDS       T01087                                 

Definition
hexokinase, putative (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_1049540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_1049540
   00051 Fructose and mannose metabolism
    RCOM_1049540
   00052 Galactose metabolism
    RCOM_1049540
   00500 Starch and sucrose metabolism
    RCOM_1049540
   00520 Amino sugar and nucleotide sugar metabolism
    RCOM_1049540
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    RCOM_1049540
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     RCOM_1049540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MGKVAVGAAAVCAAAVCASAALVVRHRMKSSGRWTRAMAILGEFEEKCGTPVGKLRQVAD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKEDR
VVKQEFEEVSIPPHLMIGSSDALFDFIADALKKFVATEGEDLHPLPGQQRELGFTFSFPV
RQASIASGTLIKWTKGFSIEDTVGEDVVGELTKAMDRVGLDMRVAALVNDTIGTLAGGRY
HSQDVIAGVILGTGTNAAYVERAQAIPKWHGLLPKSDEMVINMEWGNFRSSHLPLTEYDE
ALDIESLNPGEQIFEKIISGMYLGEIVRRVLLKMAEEANLFGDVVPPKLEIPFILRTPVM
SAMHQDTSSDLRVVGSKLKDILEIPNTSLKTRKAIVKLCDIVATRGARLSAAGIVGILKK
LGRDTIKEREKHKSVIAMDGGLFEHYTKFRVCLESTIEELLGKEVSENIVVEHSNDGSGI
GAALLAASHSLYREVAEY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcggccgtgtgtgcagcggcggtgtgtgcgtcggcg
gcactagtggtgaggcataggatgaagagctcaggaaggtggaccagagccatggcgata
cttggagagtttgaagagaagtgtggcacccctgtcggaaaattaagacaggtggcagat
gctatgaccgtcgagatgcatgctggtcttgcatcggagggtggtagtaaacttaagatg
atcattagctacgttgataatcttcctaccggggatgagaaggggctgttttatgcatta
gaccttggtggcacaaattttcgcgtcttacgtgtacttttgggagggaaagaagatcgt
gttgtcaaacaagaatttgaggaagtttctattcctccacacttgatgattggatcttca
gatgcattattcgattttattgcggacgcacttaaaaagtttgttgctacagaaggtgaa
gacttgcaccctttgcctggtcaacaaagggaactgggctttaccttctcattcccagtt
aggcaagcgtcaatagcatcaggaactcttataaaatggacaaaaggtttctctatagaa
gatacagttggggaagatgtggtaggagaattgacaaaagccatggacagagttggtctt
gacatgcgtgttgcagctttggtcaatgatacaattggaacattagctggaggtagatac
cacagccaggatgttattgctggagtaatcttgggcactggaacaaatgcagcctatgta
gaacgggcacaagcaattcccaagtggcatggtcttctacctaaatcagatgaaatggta
atcaatatggagtggggtaacttccgatcatcacaccttccacttacagaatatgatgag
gctctggatattgagtctctgaacccaggggaacagattttcgagaagatcatttctggt
atgtatttgggagagattgtacggagagttctgttgaagatggccgaggaagctaacctt
tttggtgatgttgttccaccaaaactggagattccattcattctaaggactcctgtcatg
tcagctatgcatcaagatacatcttcagatctgagagtcgttggaagcaaactaaaggat
atcttagagatacctaatacctctctgaaaacgaggaaagctatagttaagctttgtgac
attgttgccactcgtggtgcccgcctctctgcagccggaatagtaggcatactcaagaaa
ttgggaagagacacaataaaggaaagggaaaagcataagtcagtaatagcaatggatgga
gggctttttgagcactacactaagtttcgtgtatgcttggagagcacgattgaggagttg
ctgggaaaggaagtttctgagaacattgttgttgagcactcaaatgatggctcaggcatc
ggagcagctctgctggcagcttcccactccctataccgggaggttgctgaatactga

DBGET integrated database retrieval system