KEGG   Ricinus communis (castor bean): RCOM_1050320Help
Entry
RCOM_1050320      CDS       T01087                                 

Definition
cell division cycle, putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
rcu  Ricinus communis (castor bean)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:rcu04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 751 aa AA seqDB search
MEGILKDCVNNSLRHFMYRNAMFMCERLCAEFPSETNLQLLAGCYLQNNQAYSAYHILKG
THMAQSRYLFAISCFQMDLLNEAEAVLCPANEPSAEVPNGAAGHYLLGLIYRYTDRRKNA
ILHFKQALSIDPLLWAAYEELCILGAAEEATALFGEAAAVCIQKQCVNHASAFQNVQISS
EDHNLLSARNSGLEDVSPRQLKHVQGNNLRDIPSAASQPPNGGPPNLPFYNTPSPMASQL
SGVAPPPLCRIAQPNGPNPSSLCAENSARSTVNSTIQAPRRKFVDEGKLRKISGRLFSDS
GPRRSTRLAAEAGTTNSNASTTLATGNGISNSSKYLGGSKLSSIALRPVTIRKGQSWGNE
NYNEGIRNDTFDDSRVSAATTNSSSSPSSDARCLESEGPSITVGGVIMSTAKVLSGASEI
LGLLRILGEGYRLSCLYRCQDALDTYMKLPGKHYNTGWVLSQVGKAYFELVDYLEADRAF
SLARRASPYSLEGLDIYSTVLYHLKEDMKLSYLAQELISTDRLAPESWCAMGNCFSLQKD
HETALKNFQRAVQLNSRFTYAHTLCGHEYVALEDFENGIKSYQSALRIDARHYNSWYGLG
MVYLRLEKFEFSEHHFQMAFQINPRSSVIMSYLGTALHALKRNREALEMMERAILADKKN
PLPMYQKANILVSLESFEEALEVLEELKEYAPRESSVYALMGKIYKRRNMHEKAMLHFGL
ALDLKPSATDVATIKAAIEKLHVPDEIEDSL
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatactaaaagactgtgtgaacaacagtctccgccatttcatgtaccgcaac
gccatgttcatgtgcgagcgtctttgcgccgagtttccttctgagacaaatttacaatta
ttagccggatgttatttgcaaaataatcaagcctactctgcatatcatattctaaaagga
acacatatggctcaatcccgctacttgtttgcgatatcatgctttcagatggatcttcta
aatgaagctgaagcagtgttatgtcctgccaatgaacctagtgcagaggttccaaatggt
gcagctgggcattatcttctcgggcttatttacaggtatactgatagaaggaaaaatgca
attcttcatttcaagcaggctttgtcaatagatcctctactctgggctgcatatgaggag
ctgtgcatattaggtgctgctgaagaggcaactgcactttttggtgaagcagctgctgtt
tgcatccaaaagcagtgtgtaaaccatgcatcagctttccaaaatgtccagatctccagt
gaggatcataatttactctctgctagaaactctggtttggaagatgttagtccaaggcag
ttgaagcacgtgcaaggtaataacctaagagatattccttcagctgccagtcaacctcct
aatggtggccctccaaatttaccattttataatactccttcgccaatggcctcacagttg
tctggtgtcgctccaccacctttgtgtagaattgctcagccaaatggtccaaatcctagc
tcactctgtgccgaaaattctgcaaggtctactgtgaactctactattcaagcccctcga
agaaaatttgttgatgaagggaaattacggaagatttctgggaggctattttctgattct
ggccctcgacgaagtacaagacttgctgctgaagcagggacaaccaactcaaatgcaagt
accacactggcaacagggaatggaattagcaactcttctaaatatctcggtggttctaaa
ctgagctctatagcactacgtcctgtgaccattcgtaaagggcagtcatggggcaatgaa
aattataatgaagggatacgcaacgatacttttgatgattcgcgtgtgagtgctgcaaca
acaaattctagttcatcaccttctagtgatgctagatgtcttgaatccgaaggaccgtct
ataacagttggtggagttataatgagcactgcaaaggtcttaagtggtgcttcagaaata
ttaggtctcttgagaattctcggagaaggctatagactttcttgcttgtacaggtgccag
gatgcattggatacctatatgaagctacctggcaagcattataatacaggctgggtactt
tcccaggttgggaaagcttattttgaattagtggattacttagaggctgatagggctttc
agtcttgcccgtcgagcatcaccttacagtttagaaggattggatatatattccacggtc
ctttatcatttaaaggaggacatgaagttgagttacttggcccaagaactgatatcaact
gatcgcttagctcctgaatcttggtgtgccatgggaaattgctttagtttgcaaaaagac
catgaaactgccctgaaaaattttcagcgggctgtgcagcttaattcaagatttacatat
gctcacaccctttgtggtcatgaatatgtagctttagaggattttgagaatggaattaag
agttaccagagtgcactacgaattgatgctagacattataattcctggtatgggcttggg
atggtctacctccggctagagaagttcgagttctcagagcatcacttccaaatggctttt
caaataaatccacggtcctctgtcattatgtcgtatcttgggacggctttgcatgcttta
aagagaaatagggaagctttggagatgatggagagggctattttagctgataagaagaac
cctcttcccatgtatcagaaggctaatatacttgtgagcttggaaagttttgaggaagct
ctagaagtcttagaagagctgaaggagtatgctcctcgtgaaagcagtgtatatgctttg
atgggtaagatctataagaggcgtaacatgcatgagaaagcgatgcttcattttggtctt
gctctggatttaaaaccatcagcaactgatgttgctacaattaaggcggccattgaaaag
ctgcatgtaccagatgagatagaagacagcttgtag

DBGET integrated database retrieval system